We are currently updating the database - data may be missing for the next 10 minutes. We apologize for any inconvenience.

Human Metabolome Database Version 2.5

 

Showing metabocard for B-Carotene (HMDB00561)

Legend: metabolite field enzyme field

Version 2.5
Creation Date 2005-11-16 15:48:42
Update Date 2010-04-12 10:59:37
Accession Number HMDB00561
Secondary Accession Numbers Not Available
Common Name B-Carotene
Description A carotenoid that is a precursor of vitamin A. It is administered to reduce the severity of photosensitivity reactions in patients with erythropoietic protoporphyria (porphyria, erythropoietic). (From Reynolds JEF(Ed): Martindale: The Extra Pharmacopoeia (electronic version). Micromedex, Inc, Engewood, CO, 1995.) -- Pubchem; Carotene is an orange photosynthetic pigment important for photosynthesis. It is responsible for the orange colour of the carrot and many other fruits and vegetables. It contributes to photosynthesis by transmitting the light energy it absorbs to chlorophyll. Chemically, carotene is a terpene. It is the dimer of retinol (vitamin A) and comes in two primary forms: alpha- and beta-carotene. gamma-, delta- and epsilon-carotene also exist. Carotene can be stored in the liver and converted to vitamin A as needed. Beta-carotene is an anti-oxidant and such can be useful for curbing the excess of damaging free radicals in the body. However, the usefulness of beta-carotene as a dietary supplement (i.e. taken as a pill) is still subject to debate. Beta-carotene is fat-soluble, so a small amount of fat is needed to absorb it into the body. -- Wikipedia
Synonyms
  1. (all-E)-1,1'-(3,7,12,16-Tetramethyl-1,3,5,7,9,11,13,15,17-octadecanonaene-1,18-diyl)bis
  2. (all-E)-1,1'-(3,7,12,16-tetramethyl-1,3,5,7,9,11,13,15,17-octadecanonaene-1,18-diyl)bis[2,6,6-trimethyl-Cyclohexene
  3. BetaVit
  4. Betacarotene
  5. Carotaben
  6. Carotene Base 80S
  7. Food Orange 5
  8. KPMK
  9. Lucaratin
  10. Lucarotin
  11. Lurotin
  12. Provatene
  13. Provatenol
  14. Rovimix b-carotene
  15. Serlabo
  16. Solatene
  17. all-E-b-Carotene
  18. all-trans-b-Carotene
  19. b-Carotene
  20. beta-Carotene
  21. all-epsilon-beta-Carotene
  22. all-trans-beta-Carotene
Chemical IUPAC Name (1E,3E,5E,7E,9E,11E,13E,15E,17E)-3,7,12,16-tetramethyl-1,18-bis(2,6,6-trimethyl-1-cyclohexenyl)octadeca-1,3,5,7,9,11,13,15,17-nonaene
Chemical Formula C40H56
Chemical Structure Structure
Chemical Taxonomy
Kingdom
  • Organic
Super Class
  • Miscellanous
Class
  • Alkanes and Alkenes
Sub Class
  • Carotenes
Family
  • Mammalian Metabolite
Species
  • alkene
Biofunction
  • Anti-oxidant
  • Component of Retinol metabolism
Application
Source
  • Endogenous
Average Molecular Weight 536.873
Monoisotopic Molecular Weight 536.438232
Isomeric SMILES CC(C=CC=C(C)C=CC1=C(C)CCCC1(C)C)=C/C=C/C=C(C)/C=C/C=C(C)/C=C/C1=C(C)CCCC1(C)C
Canonical SMILES CC(C=CC=C(C)C=CC1=C(C)CCCC1(C)C)=CC=CC=C(C)C=CC=C(C)C=CC1=C(C)CCCC1(C)C
KEGG Compound ID C02094 Link Image
BioCyc ID CPD1F-129 Link Image
BiGG ID 2264935 Link Image
Wikipedia Link Betacarotene Link Image
NuGOwiki Link HMDB00561 Link Image
Metagene Link HMDB00561 Link Image
METLIN ID 5545 Link Image
PubChem Compound 5280489 Link Image
PubChem Substance 11064512 Link Image
ChEBI ID 17579 Link Image
CAS Registry Number 7235-40-7
InChI Identifier InChI=1/C40H56/c1-31(19-13-21-33(3)25-27-37-35(5)23-15-29-39(37,7)8)17-11-12-18-32(2)20-14-22-34(4)26-28-38-36(6)24-16-30-40(38,9)10/h11-14,17-22,25-28H,15-16,23-24,29-30H2,1-10H3/b12-11+,19-13+,20-14+,27-25+,28-26+,31-17+,32-18+,33-21+,34-22+
Synthesis Reference Not Available
Melting Point (Experimental) 183 oC
Experimental Water Solubility 0.6 mg/mL [YALKOWSKY,SH & DANNENFELSER,RM (1992)] Source: PhysProp
Predicted Water Solubility 3.91e-04 mg/mL [Predicted by ALOGPS] Calculated using ALOGPS
Physiological Charge 0
State Solid
Experimental LogP/Hydrophobicity Not Available Source: PhysProp
Predicted LogP/Hydrophobicity 9.72 [Predicted by ALOGPS]; 10.292 [Predicted by PubChem via XLOGP]; 17.62 [MEYLAN,WM & HOWARD,PH (1995)] Calculated using ALOGPS
Material Safety Data Sheet (MSDS)
MOL File Show Link Image
SDF File Show Link Image
PDB File Show Link Image
2D Structure
3D Structure
Experimental PDB ID Not Available
Experimental 1H NMR Spectrum Download FID (Varian)
Show Experimental Conditions Link Image
Experimental 13C NMR Spectrum Not Available
Experimental 13C HSQC Spectrum Download Spectrum
Download FID (Bruker)
Show Experimental Conditions Link Image
Predicted 1H NMR Spectrum Show Image
Show Peaklist
Predicted 13C NMR Spectrum Show Image
Show Peaklist
Mass Spectrum
Low Energy
Download File
Show Experimental Conditions Link Image
Medium Energy
Download File
Show Experimental Conditions Link Image
High Energy
Download File
Show Experimental Conditions Link Image
Simplified TOCSY Spectrum Not Available
BMRB Spectrum Not Available
Cellular Location
  • Membrane (Predicted from LogP)
  • Cytoplasm
  • Extracellular
Biofluid Location
  • Blood
Tissue Location
Tissue References
Adipose Tissue
Adrenal Gland
Erythrocyte
Fibroblasts
Intestine
Liver
Placenta
Platelet
Prostate
Skin
Spleen
Stratum Corneum
Concentrations (Normal)
Biofluid Blood
Value 1.0 (0.32 - 1.83) uM
Age Adult:>18 yrs old
Sex N/A
Patient information Normal
Comments Not Available
References
  • Dijkhuizen MA, Wieringa FT, West CE, Muhilal: Zinc plus beta-carotene supplementation of pregnant women is superior to beta-carotene supplementation alone in improving vitamin A status in both mothers and infants. Am J Clin Nutr. 2004 Nov;80(5):1299-307. [PubMed Link Image]
Biofluid Blood
Value 0.82 +/- 0.58 uM
Age Children:1-13 yrs old
Sex Both
Patient information Normal
Comments Not Available
References
  • Geigy Scientific Tables, 8th Rev edition, pp. 165-177. Edited by C. Lentner, West Cadwell, N.J.: Medical education Div., Ciba-Geigy Corp., Basel, Switzerland c1981-1992.
Biofluid Blood
Value 1.59 +/- 0.53 uM
Age Adult:>18 yrs old
Sex Male
Patient information Normal
Comments Not Available
References
  • Geigy Scientific Tables, 8th Rev edition, pp. 165-177. Edited by C. Lentner, West Cadwell, N.J.: Medical education Div., Ciba-Geigy Corp., Basel, Switzerland c1981-1992.
Biofluid Blood
Value 1.75 +/- 0.64 uM
Age Adult:>18 yrs old
Sex Female
Patient information Normal
Comments Not Available
References
  • Geigy Scientific Tables, 8th Rev edition, pp. 165-177. Edited by C. Lentner, West Cadwell, N.J.: Medical education Div., Ciba-Geigy Corp., Basel, Switzerland c1981-1992.
Biofluid Blood
Value 0.42 (0.19-0.72) uM
Age Adult:>18 yrs old
Sex Female
Patient information Normal
Comments Not Available
References
  • Jeong NH, Song ES, Lee JM, Lee KB, Kim MK, Yun YM, Lee JK, Son SK, Lee JP, Kim JH, Hur SY, Kwon YI: Preoperative levels of plasma micronutrients are related to endometrial cancer risk. Acta Obstet Gynecol Scand. 2009;88(4):434-9. [PubMed Link Image]
Biofluid Blood
Value 1.18 +/- 0.06 uM
Age Adult:>18 yrs old
Sex Both
Patient information Normal
Comments Not Available
References
  • Cappuccio FP, Rink E, Perkins-Porras L, McKay C, Hilton S, Steptoe A: Estimation of fruit and vegetable intake using a two-item dietary questionnaire: a potential tool for primary health care workers. Nutr Metab Cardiovasc Dis. 2003 Feb;13(1):12-9. [PubMed Link Image]
Biofluid Blood
Value 1.01 +/- 0.08 uM
Age Adult:>18 yrs old
Sex Male
Patient information Normal
Comments Not Available
References
  • Cappuccio FP, Rink E, Perkins-Porras L, McKay C, Hilton S, Steptoe A: Estimation of fruit and vegetable intake using a two-item dietary questionnaire: a potential tool for primary health care workers. Nutr Metab Cardiovasc Dis. 2003 Feb;13(1):12-9. [PubMed Link Image]
Biofluid Blood
Value 0.56 (0.23-3.92) uM
Age Adolescent:13-18 yrs old
Sex Both
Patient information Normal
Comments Not Available
References
  • Jakob E, Elmadfa I: Rapid HPLC assay for the assessment of vitamin K1, A, E and beta-carotene status in children (7-19 years). Int J Vitam Nutr Res. 1995;65(1):31-5. [PubMed Link Image]
Concentrations (Abnormal)
Biofluid Blood
Value 0.30 (0.15-0.45) uM
Age Adult:>18 yrs old
Sex Female
Condition Endometrial cancer
Comments Not Available
References
  • Jeong NH, Song ES, Lee JM, Lee KB, Kim MK, Yun YM, Lee JK, Son SK, Lee JP, Kim JH, Hur SY, Kwon YI: Preoperative levels of plasma micronutrients are related to endometrial cancer risk. Acta Obstet Gynecol Scand. 2009;88(4):434-9. [PubMed Link Image]
Associated Disorders
Condition References
Endometrial cancer
  • Jeong NH, Song ES, Lee JM, Lee KB, Kim MK, Yun YM, Lee JK, Son SK, Lee JP, Kim JH, Hur SY, Kwon YI: Preoperative levels of plasma micronutrients are related to endometrial cancer risk. Acta Obstet Gynecol Scand. 2009;88(4):434-9. [PubMed Link Image]
OMIM ID
Pathways
Name SMPDB Link KEGG Link
Retinol Metabolism SMP00074 Link Image map00830 Link Image
General References
  1. Rushin WG, Catignani GL, Schwartz SJ: Determination of beta-carotene and its cis isomers in serum. Clin Chem. 1990 Nov;36(11):1986-9. [PubMed Link Image]
  2. Vahlquist A, Lee JB, Michaelsson G, Rollman O: Vitamin A in human skin: II Concentrations of carotene, retinol and dehydroretinol in various components of normal skin. J Invest Dermatol. 1982 Aug;79(2):94-7. [PubMed Link Image]
  3. Bacic-Vrca V, Skreb F, Cepelak I, Mayer L, Kusic Z, Petres B: The effect of antioxidant supplementation on superoxide dismutase activity, Cu and Zn levels, and total antioxidant status in erythrocytes of patients with Graves' disease. Clin Chem Lab Med. 2005;43(4):383-8. [PubMed Link Image]
  4. Wu K, Erdman JW Jr, Schwartz SJ, Platz EA, Leitzmann M, Clinton SK, DeGroff V, Willett WC, Giovannucci E: Plasma and dietary carotenoids, and the risk of prostate cancer: a nested case-control study. Cancer Epidemiol Biomarkers Prev. 2004 Feb;13(2):260-9. [PubMed Link Image]
  5. Huang C, Tang YL, Chen CY, Chen ML, Chu CH, Hseu CT: The bioavailability of beta-carotene in stir- or deep-fried vegetables in men determined by measuring the serum response to a single ingestion. J Nutr. 2000 Mar;130(3):534-40. [PubMed Link Image]
  6. Gerber M: Qualitative methods to evaluate Mediterranean diet in adults. Public Health Nutr. 2006 Feb;9(1A):147-51. [PubMed Link Image]
  7. El-Sohemy A, Baylin A, Kabagambe E, Ascherio A, Spiegelman D, Campos H: Individual carotenoid concentrations in adipose tissue and plasma as biomarkers of dietary intake. Am J Clin Nutr. 2002 Jul;76(1):172-9. [PubMed Link Image]
  8. Gollnick HP, Siebenwirth C: Beta-carotene plasma levels and content in oral mucosal epithelium is skin type associated. Skin Pharmacol Appl Skin Physiol. 2002 Sep-Oct;15(5):360-6. [PubMed Link Image]
  9. Lee J, Jiang S, Levine N, Watson RR: Carotenoid supplementation reduces erythema in human skin after simulated solar radiation exposure. Proc Soc Exp Biol Med. 2000 Feb;223(2):170-4. [PubMed Link Image]
  10. Stahl W, Schwarz W, Sundquist AR, Sies H: cis-trans isomers of lycopene and beta-carotene in human serum and tissues. Arch Biochem Biophys. 1992 Apr;294(1):173-7. [PubMed Link Image]
  11. Stahl W, Heinrich U, Jungmann H, Sies H, Tronnier H: Carotenoids and carotenoids plus vitamin E protect against ultraviolet light-induced erythema in humans. Am J Clin Nutr. 2000 Mar;71(3):795-8. [PubMed Link Image]
  12. Chanarat N, Chanarat P, Viratsethasin K, Suttajit M, Chiewsilp D: Biochemical and hematological manifestations of HIV/AIDS in Chiang Mai, Thailand. Southeast Asian J Trop Med Public Health. 2001 Sep;32(3):500-3. [PubMed Link Image]
  13. Heinrich U, Gartner C, Wiebusch M, Eichler O, Sies H, Tronnier H, Stahl W: Supplementation with beta-carotene or a similar amount of mixed carotenoids protects humans from UV-induced erythema. J Nutr. 2003 Jan;133(1):98-101. [PubMed Link Image]
  14. Poor CL, Bierer TL, Merchen NR, Fahey GC Jr, Murphy MR, Erdman JW Jr: Evaluation of the preruminant calf as a model for the study of human carotenoid metabolism. J Nutr. 1992 Feb;122(2):262-8. [PubMed Link Image]
  15. Lakshman MR: Alpha and omega of carotenoid cleavage. J Nutr. 2004 Jan;134(1):241S-245S. [PubMed Link Image]
  16. Kirsh VA, Hayes RB, Mayne ST, Chatterjee N, Subar AF, Dixon LB, Albanes D, Andriole GL, Urban DA, Peters U: Supplemental and dietary vitamin E, beta-carotene, and vitamin C intakes and prostate cancer risk. J Natl Cancer Inst. 2006 Feb 15;98(4):245-54. [PubMed Link Image]
  17. McArdle F, Rhodes LE, Parslew RA, Close GL, Jack CI, Friedmann PS, Jackson MJ: Effects of oral vitamin E and beta-carotene supplementation on ultraviolet radiation-induced oxidative stress in human skin. Am J Clin Nutr. 2004 Nov;80(5):1270-5. [PubMed Link Image]
  18. Metnitz GH, Fischer M, Bartens C, Steltzer H, Lang T, Druml W: Impact of acute renal failure on antioxidant status in multiple organ failure. Acta Anaesthesiol Scand. 2000 Mar;44(3):236-40. [PubMed Link Image]
  19. Zhou JF, Chen P, Yang JL, Zhu YG, Peng CH, Wu YL: Oxidative stress before and after operation in patients with chronic cholecystitis containing gallstone. Biomed Environ Sci. 2000 Dec;13(4):254-62. [PubMed Link Image]
  20. Dimenstein R, Trugo NM, Donangelo CM, Trugo LC, Anastacio AS: Effect of subadequate maternal vitamin-A status on placental transfer of retinol and beta-carotene to the human fetus. Biol Neonate. 1996;69(4):230-4. [PubMed Link Image]
  21. Wikipedia Link Image
Metabolic Enzymes
  1. Beta,beta-carotene 15,15'-monooxygenase
Enzyme 1 [top]
Enzyme 1 ID 6864
Enzyme 1 Name Beta,beta-carotene 15,15'-monooxygenase
Enzyme 1 Synonyms
  1. Beta-carotene dioxygenase 1
Enzyme 1 Gene Name BCMO1
Enzyme 1 Protein Sequence >Beta,beta-carotene 15,15'-monooxygenase
MDIIFGRNRKEQLEPVRAKVTGKIPAWLQGTLLRNGPGMHTVGESRYNHWFDGLALLHSF
TIRDGEVYYRSKYLRSDTYNTNIEANRIVVSEFGTMAYPDPCKNIFSKAFSYLSHTIPDF
TDNCLINIMKCGEDFYATSETNYIRKINPQTLETLEKVDYRKYVAVNLATSHPHYDEAGN
VLNMGTSIVEKGKTKYVIFKIPATVPEGKKQGKSPWKHTEVFCSIPSRSLLSPSYYHSFG
VTENYVIFLEQPFRLDILKMATAYIRRMSWASCLAFHREEKTYIHIIDQRTRQPVQTKFY
TDAMVVFHHVNAYEEDGCIVFDVIAYEDNSLYQLFYLANLNQDFKENSRLTSVPTLRRFA
VPLHVDKNAEVGTNLIKVASTTATALKEEDGQVYCQPEFLYEGLELPRVNYAHNGKQYRY
VFATGVQWSPIPTKIIKYDILTKSSLKWREDDCWPAEPLFVPAPGAKDEDDGVILSAIVS
TDPQKLPFLLILDAKSFTELARASVDVDMHMDLHGLFITDMDWDTKKQAASEEQRDRASD
CHGAPLT
Enzyme 1 Number of Residues 547
Enzyme 1 Molecular Weight 62636.7
Enzyme 1 Theoretical pI 6.66
Enzyme 1 GO Classification Not Available
Enzyme 1 General Function Secondary metabolites biosynthesis, transport and catabolism
Enzyme 1 Specific Function Symmetrically cleaves beta-carotene into two molecules of retinal. The reaction proceeds in three stages, epoxidation of the 15,15'-double bond, hydration of the double bond leading to ring opening, and oxidative cleavage of the diol formed
Enzyme 1 Pathways
Enzyme 1 Reactions
  • beta-carotene + O2 = 2 retinal [RN:R00032]
Enzyme 1 Pfam Domain Function
Enzyme 1 Signals
  • None
Enzyme 1 Transmembrane Regions
  • None
Enzyme 1 Essentiality Not Available
Enzyme 1 GenBank ID Protein Not Available
Enzyme 1 UniProtKB/Swiss-Prot ID Q9HAY6 Link Image
Enzyme 1 UniProtKB/Swiss-Prot Entry Name BCDO1_HUMAN Link Image
Enzyme 1 PDB ID Not Available
Enzyme 1 Cellular Location Not Available
Enzyme 1 Gene Sequence >1644 bp
ATGGATATAATATTTGGCAGGAATAGGAAAGAACAGCTGGAGCCTGTGAGGGCCAAAGTG
ACAGGCAAGATTCCAGCATGGCTGCAGGGAACCCTGCTCCGCAACGGGCCTGGGATGCAC
ACAGTTGGGGAGTCCAGATACAACCATTGGTTCGACGGCCTTGCCCTGCTCCACAGCTTC
ACCATCAGAGACGGTGAAGTCTATTACAGGAGCAAATACCTGAGAAGCGATACCTACAAC
ACCAATATTGAGGCAAACAGGATTGTGGTGTCTGAGTTTGGAACAATGGCCTATCCGGAC
CCCTGCAAAAACATATTTTCCAAAGCTTTCTCCTACTTGTCTCACACCATCCCCGATTTC
ACCGACAACTGCCTGATCAACATCATGAAGTGCGGAGAAGACTTCTACGCGACCTCAGAG
ACCAATTACATCAGGAAAATCAACCCACAGACTCTGGAAACCCTGGAGAAGGTTGATTAT
CGTAAATACGTGGCGGTAAATCTGGCAACGTCACATCCCCATTATGATGAGGCTGGAAAT
GTTCTAAACATGGGCACATCCATTGTGGAAAAGGGGAAGACAAAGTATGTGATTTTTAAG
ATCCCTGCCACAGTACCAGAGGGCAAGAAGCAGGGGAAGAGCCCCTGGAAGCACACAGAG
GTGTTCTGCTCCATCCCATCCCGCTCCCTGCTCTCCCCAAGCTACTACCACAGCTTTGGA
GTCACCGAGAACTATGTCATCTTCCTTGAGCAGCCTTTCAGGTTGGATATTCTCAAGATG
GCAACCGCATACATCCGGAGAATGAGCTGGGCCTCCTGCCTGGCTTTCCACAGGGAGGAG
AAGACTTATATCCACATCATCGACCAAAGGACCAGGCAGCCTGTGCAGACCAAGTTTTAC
ACAGACGCCATGGTGGTCTTCCATCACGTCAACGCCTACGAAGAGGACGGCTGCATCGTG
TTTGACGTCATTGCCTACGAGGACAACAGCCTCTACCAGCTCTTCTACCTGGCCAACCTG
AACCAGGACTTCAAGGAGAACTCCAGGCTCACCTCGGTCCCCACCCTCAGGAGGTTTGCC
GTGCCCCTCCACGTGGACAAGAATGCAGAAGTGGGCACAAATTTAATCAAAGTGGCATCT
ACAACAGCCACGGCCCTGAAGGAAGAAGATGGCCAAGTCTACTGCCAGCCGGAATTTCTT
TATGAAGGCTTAGAGCTTCCACGGGTCAATTATGCTCACAATGGAAAGCAATACCGATAT
GTCTTTGCTACAGGAGTTCAGTGGAGTCCAATCCCAACCAAGATAATAAAATATGACATT
CTCACAAAGTCATCCTTAAAATGGAGAGAGGACGACTGCTGGCCAGCGGAACCCCTGTTT
GTGCCCGCGCCAGGTGCCAAGGATGAGGATGACGGAGTAATCTTATCAGCCATTGTCTCT
ACTGATCCCCAAAAGCTGCCTTTTCTGCTCATTCTGGATGCCAAAAGCTTTACGGAATTG
GCCCGTGCCTCTGTTGATGTCGATATGCACATGGATCTCCATGGATTATTCATTACAGAC
ATGGACTGGGACACAAAAAAGCAGGCCGCTTCTGAGGAACAGCGGGACAGGGCTTCCGAC
TGCCACGGGGCTCCTCTGACCTGA
Enzyme 1 GenBank Gene ID AF294900 Link Image
Enzyme 1 GeneCard ID BCMO1 Link Image
Enzyme 1 GenAtlas ID BCMO1 Link Image
Enzyme 1 HGNC ID HGNC:13815 Link Image
Enzyme 1 Chromosome Location 1
Enzyme 1 Locus 16q23.2
Enzyme 1 SNPs SNPJam Report Link Image
Enzyme 1 General References
  1. Yan W, Jang GF, Haeseleer F, Esumi N, Chang J, Kerrigan M, Campochiaro M, Campochiaro P, Palczewski K, Zack DJ: Cloning and characterization of a human beta,beta-carotene-15,15'-dioxygenase that is highly expressed in the retinal pigment epithelium. Genomics. 2001 Mar 1;72(2):193-202. [PubMed Link Image]
  2. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed Link Image]
  3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed Link Image]
  4. Lindqvist A, Sharvill J, Sharvill DE, Andersson S: Loss-of-function mutation in carotenoid 15,15'-monooxygenase identified in a patient with hypercarotenemia and hypovitaminosis A. J Nutr. 2007 Nov;137(11):2346-50. [PubMed Link Image]
Enzyme 1 Metabolite References Not Available