We are currently updating the database - data may be missing for the next 10 minutes. We apologize for any inconvenience.

Human Metabolome Database Version 2.5

 

Showing metabocard for Thromboxane B2 (HMDB03252)

Legend: metabolite field enzyme field

Version 2.5
Creation Date 2006-05-22 16:12:44
Update Date 2010-12-16 12:44:30
Accession Number HMDB03252
Secondary Accession Numbers HMDB05070
Common Name Thromboxane B2
Description Thromboxanes A stable, physiologically active compound formed in vivo from the prostaglandin endoperoxides. It is important in the platelet-release reaction (release of ADP and serotonin). -- Pubchem Thromboxanes are eicosanoids. The eicosanoids consist of the prostaglandins (PGs), thromboxanes (TXs), leukotrienes (LTs) and lipoxins (LXs). The PGs and TXs are collectively identified as prostanoids. Prostaglandins were originally shown to be synthesized in the prostate gland, thromboxanes from platelets (thrombocytes) and leukotrienes from leukocytes, hence the derivation of their names. All mammalian cells except erythrocytes synthesize eicosanoids. These molecules are extremely potent, able to cause profound physiological effects at very dilute concentrations. All eicosanoids function locally at the site of synthesis, through receptor-mediated G-protein linked signaling pathways.
Synonyms
  1. TXB2
Chemical IUPAC Name (E)-7-[(2S,3S,4S)-4,6-dihydroxy-2-[(E,3S)-3-hydroxyoct-1-enyl]oxan-3-yl]hept-5-enoic acid
Chemical Formula C20H34O6
Chemical Structure Structure
Chemical Taxonomy
Kingdom
  • Organic
Super Class
  • Organic acids
Class
  • Prostanoids
Sub Class
  • Thromboxanes
Family
  • Mammalian Metabolite
Species
  • hemiacetal
  • secondary alcohol
  • carboxylic acid
  • alkene
  • heterocyclic compound
Biofunction
—
Application
—
Source
  • Endogenous
Average Molecular Weight 370.480
Monoisotopic Molecular Weight 370.235535
Isomeric SMILES CCCCC[C@H](O)C=C[C@H]1OC(O)C[C@H](O)[C@@H]1CC=C/CCCC(O)=O
Canonical SMILES CCCCCC(O)C=CC1OC(O)CC(O)C1CC=CCCCC(O)=O
KEGG Compound ID C05963 Link Image
BioCyc ID Not Available
BiGG ID Not Available
Wikipedia Link Thromboxane B2 Link Image
NuGOwiki Link HMDB03252 Link Image
Metagene Link HMDB03252 Link Image
METLIN ID 422 Link Image
PubChem Compound 5283137 Link Image
PubChem Substance 4266092 Link Image
ChEBI ID Not Available
CAS Registry Number 54397-85-2
InChI Identifier InChI=1/C20H34O6/c1-2-3-6-9-15(21)12-13-18-16(17(22)14-20(25)26-18)10-7-4-5-8-11-19(23)24/h4,7,12-13,15-18,20-22,25H,2-3,5-6,8-11,14H2,1H3,(H,23,24)/b7-4-,13-12+/t15-,16-,17-,18+,20?/m0/s1
Synthesis Reference Not Available
Melting Point (Experimental) Not Available
Experimental Water Solubility Not Available Source: PhysProp
Predicted Water Solubility 0.246 mg/mL [Predicted by ALOGPS] Calculated using ALOGPS
Physiological Charge -1
State Solid
Experimental LogP/Hydrophobicity Not Available Source: PhysProp
Predicted LogP/Hydrophobicity 3.18 [Predicted by ALOGPS]; 3.225 [Predicted by PubChem via XLOGP] Calculated using ALOGPS
Material Safety Data Sheet (MSDS)
MOL File Show Link Image
SDF File Show Link Image
PDB File Show Link Image
2D Structure
3D Structure
Experimental PDB ID Not Available
Experimental 1H NMR Spectrum Not Available
Experimental 13C NMR Spectrum Not Available
Experimental 13C HSQC Spectrum Not Available
Predicted 1H NMR Spectrum Show Image
Show Peaklist
Predicted 13C NMR Spectrum Show Image
Show Peaklist
Mass Spectrum Not Available
Simplified TOCSY Spectrum Not Available
BMRB Spectrum Not Available
Cellular Location
  • Membrane (Predicted from LogP)
Biofluid Location
  • Blood
  • Cerebrospinal Fluid
  • Urine
Tissue Location
Tissue References
Adipose Tissue —
Bladder —
Epidermis —
Lung —
Muscle —
Nerve Cells —
Neuron —
Pancreas —
Placenta —
Platelet —
Prostate —
Skeletal Muscle —
Spleen —
Testes —
Concentrations (Normal)
Biofluid Blood
Value 0.95 +/- 0.24 uM
Age Adult:>18 yrs old
Sex Both
Patient information Normal
Comments Not Available
References
  • Renda G, Tacconelli S, Capone ML, Sacchetta D, Santarelli F, Sciulli MG, Zimarino M, Grana M, D'Amelio E, Zurro M, Price TS, Patrono C, De Caterina R, Patrignani P: Celecoxib, ibuprofen, and the antiplatelet effect of aspirin in patients with osteoarthritis and ischemic heart disease. Clin Pharmacol Ther. 2006 Sep;80(3):264-74. [PubMed Link Image]
Biofluid Blood
Value 0.0214 +/- 0.0409 uM
Age Adult:>18 yrs old
Sex Both
Patient information Normal
Comments Oxygenated lipids were quantified by Theresa L. Pedersen and John W. Newman at the USDA’s Western Human Nutrition Research Center, Davis, CA, and Lipomics Technologies, Inc.
References
  • Psychogios N, Hau DD, Peng J, Guo AC, Mandal R, Bouatra S, Sinelnikov I, Krishnamurthy R, Eisner R, Gautam B, Young N, Xia J, Knox C, Dong E, Huang P, Hollander Z, Pedersen TL, Smith SR, Bamforth F, Greiner R, McManus B, Newman JW, Goodfriend T, Wishart DS: The human serum metabolome. PLoS One. 2011 Feb 16;6(2):e16957. [PubMed Link Image]
  • Wishart DS, Knox C, Guo AC, Eisner R, Young N, Gautam B, Hau DD, Psychogios N, Dong E, Bouatra S, Mandal R, Sinelnikov I, Xia J, Jia L, Cruz JA, Lim E, Sobsey CA, Shrivastava S, Huang P, Liu P, Fang L, Peng J, Fradette R, Cheng D, Tzur D, Clements M, Lewis A, De Souza A, Zuniga A, Dawe M, Xiong Y, Clive D, Greiner R, Nazyrova A, Shaykhutdinov R, Li L, Vogel HJ, Forsythe I: HMDB: a knowledgebase for the human metabolome. Nucleic Acids Res. 2008 Oct 25. [PubMed Link Image]
Biofluid Blood
Value 3.7E-5 +/- 7E-6 uM
Age Adult:>18 yrs old
Sex Both
Patient information Normal
Comments Not Available
References
  • Quehenberger O, Armando AM, Brown AH, Milne SB, Myers DS, Merrill AH, Bandyopadhyay S, Jones KN, Kelly S, Shaner RL, Sullards CM, Wang E, Murphy RC, Barkley RM, Leiker TJ, Raetz CR, Guan Z, Laird GM, Six DA, Russell DW, McDonald JG, Subramaniam S, Fahy E, Dennis EA: Lipidomics reveals a remarkable diversity of lipids in human plasma. J Lipid Res. 2010 Nov;51(11):3299-305. Epub 2010 Jul 29. [PubMed Link Image]
Biofluid CSF
Value 3.322e-05 uM
Age N/A
Sex N/A
Patient information HIV-Seropositive (Neurologically normal)
Comments Not Available
References
  • Griffin DE, Wesselingh SL, McArthur JC: Elevated central nervous system prostaglandins in human immunodeficiency virus-associated dementia. Ann Neurol. 1994 May;35(5):592-7. [PubMed Link Image]
Biofluid Urine
Value 0.0526 (0.0395-0.0658) umol/mmol creatinine
Age Adult:>18 yrs old
Sex Both
Patient information Normal
Comments Not Available
References
  • Laitinen O, Seppala E, Nissila M, Vapaatalo H: Plasma levels and urinary excretion of prostaglandins in patients with rheumatoid arthritis. Clin Rheumatol. 1983 Dec;2(4):401-6. [PubMed Link Image]
Biofluid Urine
Value 0.00085 +/- 0.00015 umol/mmol creatinine
Age Adult:>18 yrs old
Sex Female
Patient information Normal
Comments Not Available
References
  • Farker K, Schweer H, Vollandt R, Nassr N, Nagel U, Seyberth HW, Hoffmann A, Oettel M: Measurements of urinary prostaglandins in young ovulatory women during the menstrual cycle and in postmenopausal women. Prostaglandins. 1997 Sep;54(3):655-64. [PubMed Link Image]
Concentrations (Abnormal)
Biofluid Blood
Value 0.027 +/- 0.048 uM
Age Adult:>18 yrs old
Sex Both
Condition Ischemic heart disease
Comments Patients with osteoarthritis (knee or hip osteoarthritis) and documented stable ischemic heart disease (defined as stable effort angina with angiographically documented coronary artery disease) who were treated with low-dose aspirin (100 mg daily)
References
  • Renda G, Tacconelli S, Capone ML, Sacchetta D, Santarelli F, Sciulli MG, Zimarino M, Grana M, D'Amelio E, Zurro M, Price TS, Patrono C, De Caterina R, Patrignani P: Celecoxib, ibuprofen, and the antiplatelet effect of aspirin in patients with osteoarthritis and ischemic heart disease. Clin Pharmacol Ther. 2006 Sep;80(3):264-74. [PubMed Link Image]
Biofluid Blood
Value 0.00019 +/- 0.00007 uM
Age Adult:>18 yrs old
Sex Female
Condition Normal
Comments Concentration in plasma from blood that was collected into tubes containing acetylsalicylic acid (aspirin)
References
  • Viinikka L, Ylikorkala O: Measurement of thromboxane B2 in human plasma or serum by radioimmunoassay. Prostaglandins. 1980 Oct;20(4):759-66. [PubMed Link Image]
Biofluid Blood
Value 0.00041 +/- 0.00018 uM
Age Adult:>18 yrs old
Sex Female
Condition Normal
Comments Concentration in plasma from blood that was collected into tubes without containing acetylsalicylic acid
References
  • Viinikka L, Ylikorkala O: Measurement of thromboxane B2 in human plasma or serum by radioimmunoassay. Prostaglandins. 1980 Oct;20(4):759-66. [PubMed Link Image]
Biofluid Blood
Value 0.00554 +/- 0.00235 uM
Age Adult:>18 yrs old
Sex Female
Condition Normal
Comments Concentration in serum after blood samples were allowed to clot at 0°C for 60 minutes
References
  • Viinikka L, Ylikorkala O: Measurement of thromboxane B2 in human plasma or serum by radioimmunoassay. Prostaglandins. 1980 Oct;20(4):759-66. [PubMed Link Image]
Biofluid Blood
Value 0.01080 +/- 0.00370 uM
Age Adult:>18 yrs old
Sex Female
Condition Normal
Comments Concentration in serum after blood samples were allowed to clot at 24°C for 60 minutes
References
  • Viinikka L, Ylikorkala O: Measurement of thromboxane B2 in human plasma or serum by radioimmunoassay. Prostaglandins. 1980 Oct;20(4):759-66. [PubMed Link Image]
Biofluid Blood
Value 0.48196 +/- 0.14576 uM
Age Adult:>18 yrs old
Sex Female
Condition Normal
Comments Concentration in serum after blood samples were allowed to clot at 37°C for 60 minutes
References
  • Viinikka L, Ylikorkala O: Measurement of thromboxane B2 in human plasma or serum by radioimmunoassay. Prostaglandins. 1980 Oct;20(4):759-66. [PubMed Link Image]
Biofluid CSF
Value 0.000032 +/- 0.00001 uM
Age Adult:>18 yrs old
Sex Both
Condition Brain tumors
Comments Not Available
References
  • Walker V, Pickard JD, Smythe PJ, Perry S: Eicosanoid production by brain tumours in vivo--evidence for intracranial compartmentation. J Neurooncol. 1991 Dec;11(3):259-62. [PubMed Link Image]
Biofluid CSF
Value 0.000267 uM
Age Children:1-13 yrs old
Sex N/A
Comments Not Available
References
  • Westcott JY, Murphy RC, Stenmark K: Eicosanoids in human ventricular cerebrospinal fluid following severe brain injury. Prostaglandins. 1987 Dec;34(6):877-87. [PubMed Link Image]
Biofluid CSF
Value 0.00220 (0.000583-0.00451) uM
Age Children:1-13 yrs old
Sex N/A
Comments Not Available
References
  • Westcott JY, Murphy RC, Stenmark K: Eicosanoids in human ventricular cerebrospinal fluid following severe brain injury. Prostaglandins. 1987 Dec;34(6):877-87. [PubMed Link Image]
Biofluid CSF
Value 0.00264 uM
Age Children:1-13 yrs old
Sex N/A
Comments Not Available
References
  • Westcott JY, Murphy RC, Stenmark K: Eicosanoids in human ventricular cerebrospinal fluid following severe brain injury. Prostaglandins. 1987 Dec;34(6):877-87. [PubMed Link Image]
Biofluid CSF
Value 0.000107 uM
Age N/A
Sex N/A
Comments Not Available
References
  • Griffin DE, Wesselingh SL, McArthur JC: Elevated central nervous system prostaglandins in human immunodeficiency virus-associated dementia. Ann Neurol. 1994 May;35(5):592-7. [PubMed Link Image]
Biofluid CSF
Value 0.000467 +/- 0.000243 uM
Age N/A
Sex N/A
Comments Not Available
References
  • Westcott JY, Murphy RC, Stenmark K: Eicosanoids in human ventricular cerebrospinal fluid following severe brain injury. Prostaglandins. 1987 Dec;34(6):877-87. [PubMed Link Image]
Biofluid CSF
Value 0.00172 (0.000945-0.00248) uM
Age Children:1-13 yrs old
Sex N/A
Comments Not Available
References
  • Westcott JY, Murphy RC, Stenmark K: Eicosanoids in human ventricular cerebrospinal fluid following severe brain injury. Prostaglandins. 1987 Dec;34(6):877-87. [PubMed Link Image]
Biofluid CSF
Value 0.00289 (0.000594-0.00711) uM
Age Children:1-13 yrs old
Sex N/A
Comments Not Available
References
  • Westcott JY, Murphy RC, Stenmark K: Eicosanoids in human ventricular cerebrospinal fluid following severe brain injury. Prostaglandins. 1987 Dec;34(6):877-87. [PubMed Link Image]
Biofluid CSF
Value 0.0117 +/- 0.00177 uM
Age N/A
Sex N/A
Comments Not Available
References
  • Rodriguez y Baena R, Gaetani P, Paoletti P: A study on cisternal CSF levels of arachidonic acid metabolites after aneurysmal subarachnoid hemorrhage. J Neurol Sci. 1988 Apr;84(2-3):329-35. [PubMed Link Image]
Biofluid CSF
Value 0.0155 +/- 0.00243 uM
Age N/A
Sex N/A
Comments Not Available
References
  • Rodriguez y Baena R, Gaetani P, Paoletti P: A study on cisternal CSF levels of arachidonic acid metabolites after aneurysmal subarachnoid hemorrhage. J Neurol Sci. 1988 Apr;84(2-3):329-35. [PubMed Link Image]
Biofluid Urine
Value 0.0024 +/- 0.00094 umol/mmol creatinine
Age Adult:>18 yrs old
Sex Female
Condition Normal
Comments Not Available
References
  • Farker K, Schweer H, Vollandt R, Nassr N, Nagel U, Seyberth HW, Hoffmann A, Oettel M: Measurements of urinary prostaglandins in young ovulatory women during the menstrual cycle and in postmenopausal women. Prostaglandins. 1997 Sep;54(3):655-64. [PubMed Link Image]
Associated Disorders
Condition References
Brain tumors
  • Walker V, Pickard JD, Smythe PJ, Perry S: Eicosanoid production by brain tumours in vivo--evidence for intracranial compartmentation. J Neurooncol. 1991 Dec;11(3):259-62. [PubMed Link Image]
Ischemic heart disease
  • Renda G, Tacconelli S, Capone ML, Sacchetta D, Santarelli F, Sciulli MG, Zimarino M, Grana M, D'Amelio E, Zurro M, Price TS, Patrono C, De Caterina R, Patrignani P: Celecoxib, ibuprofen, and the antiplatelet effect of aspirin in patients with osteoarthritis and ischemic heart disease. Clin Pharmacol Ther. 2006 Sep;80(3):264-74. [PubMed Link Image]
Normal
OMIM ID Not Available
Pathways
Name SMPDB Link KEGG Link
Arachidonic Acid Metabolism SMP00075 Link Image map00590 Link Image
General References
  1. Janssen PL, Meyboom S, van Staveren WA, de Vegt F, Katan MB: Consumption of ginger (Zingiber officinale roscoe) does not affect ex vivo platelet thromboxane production in humans. Eur J Clin Nutr. 1996 Nov;50(11):772-4. [PubMed Link Image]
  2. Turi S, Bereczki C, Torday C, Havass Z, Nemeth M: The effects of bicarbonate and acetate haemodialysis on platelet cyclic AMP concentration, thromboxane B2 release and aggregation. Pediatr Nephrol. 1991 May;5(3):327-31. [PubMed Link Image]
  3. Vissinger H, Husted SE, Kristensen SD, Nielsen HK: Platelet-derived growth factor release and antiplatelet treatment with low-dose acetylsalicylic acid. Angiology. 1993 Aug;44(8):633-8. [PubMed Link Image]
  4. Pace-Asciak CR, Rounova O, Hahn SE, Diamandis EP, Goldberg DM: Wines and grape juices as modulators of platelet aggregation in healthy human subjects. Clin Chim Acta. 1996 Mar 15;246(1-2):163-82. [PubMed Link Image]
  5. Zahavi M, Zahavi J: Concomitant in vitro platelet hypofunction and increased thromboxane B2 (TXB2) generation and enhanced in vivo platelet activation. A distinct syndrome in thrombosis? Eur J Haematol. 1997 Oct;59(4):266-7. [PubMed Link Image]
  6. Nyyssonen K, Seppanen K, Salonen JT: High-performance liquid chromatographic assay of platelet-produced thromboxane B2. J Chromatogr. 1993 Jan 29;612(1):27-32. [PubMed Link Image]
  7. Anfossi G, Trovati M, Mularoni E, Massucco P, Cavalot F, Mattiello L, Emanuelli G: Effects of diltiazem on thromboxane B2 production from platelet-rich plasma and whole blood. Prostaglandins Leukot Essent Fatty Acids. 1991 Nov;44(3):149-54. [PubMed Link Image]
  8. Laitinen O, Seppala E, Nissila M, Vapaatalo H: Plasma levels and urinary excretion of prostaglandins in patients with rheumatoid arthritis. Clin Rheumatol. 1983 Dec;2(4):401-6. [PubMed Link Image]
  9. Fuse S, Tomita H, Chiba S: Plasma thromboxane B2 concentration in patients with ventricular septal defect and pulmonary hypertension. Jpn Circ J. 1998 Mar;62(3):193-7. [PubMed Link Image]
  10. Tewes KS, Tsikas D, Gutzki FM, Frolich JC: Measurement of thromboxane B2 in platelet-rich human plasma by gas chromatography-mass spectrometry and gas chromatography-tandem mass spectrometry following extractive pentafluorobenzyl esterification. Anal Biochem. 1998 Jul 15;261(1):121-4. [PubMed Link Image]
  11. de Meijer A, Vollaard H, de Metz M, Verbruggen B, Thomas C, Novakova I: Meloxicam, 15 mg/day, spares platelet function in healthy volunteers. Clin Pharmacol Ther. 1999 Oct;66(4):425-30. [PubMed Link Image]
  12. Mistakopulo NF, Shoshiashvili VD, Saltanov AI, Kushlinskii NE, Ivshina AV, Madzhuga AI, Liakina LT, Ukrainets AM, Zabotina TN, Kadagidze ZG: [The effect of indomethacin and leukinferon on the level of blood plasma thromboxane B2, platelet aggregation and the immune system of patients with endometrial cancer in the perioperative period] Anesteziol Reanimatol. 1992 Mar-Apr;(2):14-8. [PubMed Link Image]
  13. Fuse S, Kamiya T: Plasma thromboxane B2 concentration in pulmonary hypertension associated with congenital heart disease. Circulation. 1994 Dec;90(6):2952-5. [PubMed Link Image]
  14. Wikipedia Link Image
Metabolic Enzymes
  1. Solute carrier organic anion transporter family member 2B1
Enzyme 1 [top]
Enzyme 1 ID 7479
Enzyme 1 Name Solute carrier organic anion transporter family member 2B1
Enzyme 1 Synonyms
  1. Organic anion transporter B
  2. OATP-B
  3. Organic anion transporter polypeptide-related protein 2
  4. OATP-RP2
  5. OATPRP2
  6. Solute carrier family 21 member 9
Enzyme 1 Gene Name SLCO2B1
Enzyme 1 Protein Sequence >Solute carrier organic anion transporter family member 2B1 
MGPRIGPAGEVPQVPDKETKATMGTENTPGGKASPDPQDVRPSVFHNIKLFVLCHSLLQL
AQLMISGYLKSSISTVEKRFGLSSQTSGLLASFNEVGNTALIVFVSYFGSRVHRPRMIGY
GAILVALAGLLMTLPHFISEPYRYDNTSPEDMPQDFKASLCLPTTSAPASAPSNGNCSSY
TETQHLSVVGIMFVAQTLLGVGGVPIQPFGISYIDDFAHNSNSPLYLGILFAVTMMGPGL
AFGLGSLMLRLYVDINQMPEGGISLTIKDPRWVGAWWLGFLIAAGAVALAAIPYFFFPKE
MPKEKRELQFRRKVLAVTDSPARKGKDSPSKQSPGESTKKQDGLVQIAPNLTVIQFIKVF
PRVLLQTLRHPIFLLVVLSQVCLSSMAAGMATFLPKFLERQFSITASYANLLIGCLSFPS
VIVGIVVGGVLVKRLHLGPVGCGALCLLGMLLCLFFSLPLFFIGCSSHQIAGITHQTSAH
PGLELSPSCMEACSCPLDGFNPVCDPSTRVEYITPCHAGCSSWVVQDALDNSQVFYTNCS
CVVEGNPVLAGSCDSTCSHLVVPFLLLVSLGSALACLTHTPSFMLILRGVKKEDKTLAVG
IQFMFLRILAWMPSPVIHGSAIDTTCVHWALSCGRRAVCRYYNNDLLRNRFIGLQFFFKT
GSVICFALVLAVLRQQDKEARTKESRSSPAVEQQLLVSGPGKKPEDSRV
Enzyme 1 Number of Residues 709
Enzyme 1 Molecular Weight 76697.9
Enzyme 1 Theoretical pI 8.39
Enzyme 1 GO Classification
Function
  • transporter activity
Process
  • establishment of localization
  • transport
Component
  • cell part
  • membrane
Enzyme 1 General Function Involved in transporter activity
Enzyme 1 Specific Function Mediates the Na(+)-independent transport of organic anions such as taurocholate, the prostaglandins PGD2, PGE1, PGE2, leukotriene C4, thromboxane B2 and iloprost
Enzyme 1 Pathways Not Available
Enzyme 1 Reactions Not Available
Enzyme 1 Pfam Domain Function
Enzyme 1 Signals
  • None
Enzyme 1 Transmembrane Regions
  • 118-138 186-206 225-245 277-297 371-391 412-432 443-463 557-577 597-617 651-671
Enzyme 1 Essentiality Not Available
Enzyme 1 GenBank ID Protein Not Available
Enzyme 1 UniProtKB/Swiss-Prot ID O94956 Link Image
Enzyme 1 UniProtKB/Swiss-Prot Entry Name SO2B1_HUMAN Link Image
Enzyme 1 PDB ID Not Available
Enzyme 1 Cellular Location Not Available
Enzyme 1 Gene Sequence >2130 bp 
ATGGGACCCAGGATAGGGCCAGCGGGTGAGGTACCCCAGGTACCAGACAAGGAAACCAAA
GCCACAATGGGCACAGAAAACACACCTGGAGGCAAAGCCAGCCCAGACCCTCAGGACGTG
CGGCCAAGTGTGTTCCATAACATCAAGCTGTTCGTTCTGTGCCACAGCCTGCTGCAGCTG
GCGCAGCTCATGATCTCCGGCTACCTAAAGAGCTCCATCTCCACAGTGGAGAAGCGCTTC
GGCCTCTCCAGCCAGACGTCGGGGCTGCTGGCCTCCTTCAACGAGGTGGGGAACACAGCC
TTGATTGTGTTTGTGAGCTATTTTGGCAGCCGGGTGCACCGACCCCGAATGATTGGCTAT
GGGGCTATCCTTGTGGCCCTGGCGGGCCTGCTCATGACTCTCCCGCACTTCATCTCGGAG
CCATACCGCTACGACAACACCAGCCCTGAGGATATGCCACAGGACTTCAAGGCTTCCCTG
TGCCTGCCCACAACCTCGGCCCCAGCCTCGGCCCCCTCCAATGGCAACTGCTCAAGCTAC
ACAGAAACCCAGCATCTGAGTGTGGTGGGGATCATGTTCGTGGCACAGACCCTGCTGGGC
GTGGGCGGGGTGCCCATTCAGCCCTTTGGCATCTCCTACATCGATGACTTTGCCCACAAC
AGCAACTCGCCCCTCTACCTCGGGATCCTGTTTGCAGTGACCATGATGGGGCCAGGCCTG
GCCTTTGGGCTGGGCAGCCTCATGCTGCGCCTTTATGTGGACATTAACCAGATGCCAGAA
GGTGGTATCAGCCTGACCATAAAGGACCCCCGATGGGTGGGTGCCTGGTGGCTGGGTTTC
CTCATCGCTGCCGGTGCAGTGGCCCTGGCTGCCATCCCCTACTTCTTCTTCCCCAAGGAA
ATGCCCAAGGAAAAACGTGAGCTTCAGTTTCGGCGAAAGGTCTTAGCAGTCACAGACTCA
CCTGCCAGGAAGGGCAAGGACTCTCCCTCTAAGCAGAGCCCTGGGGAGTCCACGAAGAAG
CAGGATGGCCTAGTCCAGATTGCACCAAACCTGACTGTGATCCAGTTCATTAAAGTCTTC
CCCAGGGTGCTGCTGCAGACCCTACGCCACCCCATCTTCCTGCTGGTGGTCCTGTCCCAG
GTATGCTTGTCATCCATGGCTGCGGGCATGGCCACCTTCCTGCCCAAGTTCCTGGAGCGC
CAGTTTTCCATCACAGCCTCCTACGCCAACCTGCTCATCGGCTGCCTCTCCTTCCCTTCG
GTCATCGTGGGCATCGTGGTGGGTGGCGTCCTGGTCAAGCGGCTCCACCTGGGCCCTGTG
GGATGCGGTGCCCTTTGCCTGCTGGGGATGCTGCTGTGCCTCTTCTTCAGCCTGCCGCTC
TTCTTTATCGGCTGCTCCAGCCACCAGATTGCGGGCATCACACACCAGACCAGTGCCCAC
CCTGGGCTGGAGCTGTCTCCAAGCTGCATGGAGGCCTGCTCCTGCCCATTGGACGGCTTT
AACCCTGTCTGCGACCCCAGCACTCGTGTGGAATACATCACACCCTGCCACGCAGGCTGC
TCAAGCTGGGTGGTCCAGGATGCTCTGGACAACAGCCAGGTTTTCTACACCAACTGCAGC
TGCGTGGTGGAGGGCAACCCCGTGCTGGCAGGATCCTGCGACTCAACGTGCAGCCATCTG
GTGGTGCCCTTCCTGCTCCTGGTCAGCCTGGGCTCGGCCCTGGCCTGTCTCACCCACACA
CCCTCCTTCATGCTCATCCTAAGAGGAGTGAAGAAAGAAGACAAGACTTTGGCTGTGGGC
ATCCAGTTCATGTTCCTGAGGATTTTGGCCTGGATGCCCAGCCCCGTGATCCACGGCAGC
GCCATCGACACCACCTGTGTGCACTGGGCCCTGAGCTGTGGGCGTCGAGCTGTCTGTCGC
TACTACAATAATGACCTGCTCCGAAACCGGTTCATCGGCCTCCAGTTCTTCTTCAAAACA
GGTTCTGTGATCTGCTTCGCCTTAGTTTTGGCTGTCCTGAGGCAGCAGGACAAAGAGGCA
AGGACCAAAGAGAGCAGATCCAGCCCTGCCGTAGAGCAGCAATTGCTAGTGTCGGGGCCA
GGGAAGAAGCCAGAGGATTCCCGAGTGTGA
Enzyme 1 GenBank Gene ID AB026256 Link Image
Enzyme 1 GeneCard ID SLCO2B1 Link Image
Enzyme 1 GenAtlas ID SLCO2B1 Link Image
Enzyme 1 HGNC ID HGNC:10962 Link Image
Enzyme 1 Chromosome Location 1
Enzyme 1 Locus 11q13
Enzyme 1 SNPs SNPJam Report Link Image
Enzyme 1 General References
  1. Nagase T, Ishikawa K, Suyama M, Kikuno R, Hirosawa M, Miyajima N, Tanaka A, Kotani H, Nomura N, Ohara O: Prediction of the coding sequences of unidentified human genes. XII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro. DNA Res. 1998 Dec 31;5(6):355-64. [PubMed Link Image]
  2. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed Link Image]
  3. Taylor TD, Noguchi H, Totoki Y, Toyoda A, Kuroki Y, Dewar K, Lloyd C, Itoh T, Takeda T, Kim DW, She X, Barlow KF, Bloom T, Bruford E, Chang JL, Cuomo CA, Eichler E, FitzGerald MG, Jaffe DB, LaButti K, Nicol R, Park HS, Seaman C, Sougnez C, Yang X, Zimmer AR, Zody MC, Birren BW, Nusbaum C, Fujiyama A, Hattori M, Rogers J, Lander ES, Sakaki Y: Human chromosome 11 DNA sequence and analysis including novel gene identification. Nature. 2006 Mar 23;440(7083):497-500. [PubMed Link Image]
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed Link Image]
  5. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. [PubMed Link Image]
Enzyme 1 Metabolite References Not Available