| Version |
2.5 |
| Creation Date |
2006-08-13 06:28:05 |
| Update Date |
2009-05-05 20:59:44 |
| Accession Number |
HMDB03826 |
| Secondary Accession Numbers |
Not Available |
| Common Name |
6,7-Dimethyl-8-(1-D-ribityl)lumazine |
| Description |
6,7-Dimethyl-8-(1-D-ribityl)lumazine is an intermediate in riboflavin metabolism. 6,7-Dimethyl-8-(1-D-ribityl)lumazine is the second to last step in the synthesis of ribitol and is converted from 4-(1-D-ribitylamino)-5-amino-2,6-dihydroxypyrimidine via the enzyme riboflavin synthase beta chain. It is then
converted to riboflavin via the enzyme riboflavin synthase alpha chain (EC:2.5.1.9). |
| Synonyms |
- DMDRL
- 6,7-Dimethyl-8-ribityllumazine
- 6,7-Dimethyl-8-(1'-D-ribityl)lumazine
- 6,7-dimethyl-8-(1-D-ribityl)lumazine
- 1-deoxy-1-[6,7-dimethyl-2,4-dioxo-3,4-dihydropteridin-8(2H)-yl]-D-ribitol
- 1-Deoxy-1-(3,4-dihydro-6,7-dimethyl-2,4-dioxo-8(2H)-pteridinyl)-ribitol
- 6,7-dimethyl-8-[(2S,3S,4R)-2,3,4,5-tetrahydroxypentyl]pteridine-2,4-dione
|
| Chemical IUPAC Name |
6,7-dimethyl-8-[(2S,3S,4R)-2,3,4,5-tetrahydroxypentyl]pteridine-2,4-dione |
| Chemical Formula |
C13H18N4O6 |
| Chemical Structure |
 |
| Chemical Taxonomy |
| Kingdom |
|
| Super Class |
| — |
| Class |
| — |
| Sub Class |
| — |
| Family |
|
| Species |
- primary alcohol
- secondary alcohol
- 1,2-diol
- oxo(het)arene
- aromatic compound
- heterocyclic compound
|
| Biofunction |
| — |
| Application |
| — |
| Source |
|
|
| Average Molecular Weight |
326.305 |
| Monoisotopic Molecular Weight |
326.122620 |
| Isomeric SMILES |
CC1=C(C)N(CC(O)C(O)C(O)CO)C2=NC(=O)NC(=O)C2=N1 |
| Canonical SMILES |
CC1=C(C)N(CC(O)C(O)C(O)CO)C2=NC(=O)NC(=O)C2=N1 |
| KEGG Compound ID |
C04332  |
| BioCyc ID |
DIMETHYL-D-RIBITYL-LUMAZINE  |
| BiGG ID |
Not Available |
| Wikipedia Link |
Not Available |
| NuGOwiki Link |
HMDB03826  |
| Metagene Link |
HMDB03826  |
| METLIN ID |
Not Available |
| PubChem Compound |
168989  |
| PubChem Substance |
6983  |
| ChEBI ID |
17601  |
| CAS Registry Number |
5118-16-1 |
| InChI Identifier |
InChI=1/C13H18N4O6/c1-5-6(2)17(3-7(19)10(21)8(20)4-18)11-9(14-5)12(22)16-13(23)15-11/h7-8,10,18-21H,3-4H2,1-2H3,(H,16,22,23) |
| Synthesis Reference |
Not Available |
| Melting Point (Experimental) |
Not Available |
| Experimental Water Solubility |
Not Available
Source: PhysProp
|
| Predicted Water Solubility |
1.23 mg/mL [Predicted by ALOGPS]
Calculated using ALOGPS
|
| Physiological Charge |
-1 |
| State |
Solid |
| Experimental LogP/Hydrophobicity |
-3.145
Source: PhysProp
|
| Predicted LogP/Hydrophobicity |
-3.3 [Predicted by PubChem via XLOGP]
Calculated using ALOGPS
|
| Material Safety Data Sheet (MSDS) |
Not Available |
| MOL File |
Show |
| SDF File |
Show |
| PDB File |
Show |
| 2D Structure |
|
| 3D Structure |
|
| Experimental PDB ID |
Not Available |
| Experimental 1H NMR Spectrum |
Not Available |
| Experimental 13C NMR Spectrum |
Not Available |
| Experimental 13C HSQC Spectrum |
Not Available |
| Predicted 1H NMR Spectrum |
Not Available Not Available
|
| Predicted 13C NMR Spectrum |
Not Available Not Available
|
| Mass Spectrum |
Not Available |
| Simplified TOCSY Spectrum |
Not Available |
| BMRB Spectrum |
Not Available |
| Cellular Location |
Not Available |
| Biofluid Location |
Not Available |
| Tissue Location |
Not Available |
| Concentrations (Normal) |
Not Available |
| Concentrations (Abnormal) |
Not Available |
| Associated Disorders |
Not Available |
| OMIM ID |
Not Available |
| Pathways |
|
| General References |
Not Available |
| Metabolic Enzymes |
- Riboflavin synthase alpha chain (EC 2.5.1.9)
- Riboflavin synthase alpha chain
- Riboflavin synthase alpha chain (EC 2.5.1.9)
- Riboflavin synthase alpha subunit
- Riboflavin synthase, alpha subunit (EC 2.5.1.9)
- Riboflavin synthase, alpha subunit (EC 2.5.1.9)
- Riboflavin synthase alpha chain
- Riboflavin synthase, alpha subunit
|
|
Enzyme 1
[top]
|
| Enzyme 1 ID |
16328 |
| Enzyme 1 Name |
Riboflavin synthase alpha chain (EC 2.5.1.9) |
| Enzyme 1 Synonyms |
Not Available |
| Enzyme 1 Gene Name |
ribE |
| Enzyme 1 Protein Sequence |
>Riboflavin synthase alpha chain (EC 2.5.1.9)
MFSGIVEEYATVVALVKDQENIHFTLKCSFVNELKIDQSISHNGVCLTVVSMTEDTYTVT
AMKETLDRSNLRLLKVGDKVNVERSMMMNGRLDGHIVQGHVDQTAECIDIKDADGSWYFT
FKYAFDKEMAKRGYITVDKGSVTVNGVSLTVCNPTDDTFQVAIIPYTYEHTNFHTFGKGS
VVNLEFDIIGKYISRMIQYK
|
| Enzyme 1 Number of Residues |
200 |
| Enzyme 1 Molecular Weight |
22597 |
| Enzyme 1 Theoretical pI |
5.59 |
| Enzyme 1 GO Classification |
Not Available |
| Enzyme 1 General Function |
Coenzyme transport and metabolism |
| Enzyme 1 Specific Function |
Not Available |
| Enzyme 1 Pathways |
Not Available |
| Enzyme 1 Reactions |
- 2 6,7-dimethyl-8-(1-D-ribityl)lumazine = riboflavin + 4-(1-D-ribitylamino)-5-amino-2,6-dihydroxypyrimidine [RN:R00066] ALL_REAC R00066
|
| Enzyme 1 Pfam Domain Function |
|
| Enzyme 1 Signals |
|
| Enzyme 1 Transmembrane Regions |
|
| Enzyme 1 Essentiality |
Not Available |
| Enzyme 1 GenBank ID Protein |
Not Available |
| Enzyme 1 UniProtKB/Swiss-Prot ID |
Q5LBQ6  |
| Enzyme 1 UniProtKB/Swiss-Prot Entry Name |
Q5LBQ6_BACFN  |
| Enzyme 1 PDB ID |
Not Available |
| Enzyme 1 Cellular Location |
Not Available |
| Enzyme 1 Gene Sequence |
Not Available |
| Enzyme 1 GenBank Gene ID |
CR626927  |
| Enzyme 1 GeneCard ID |
Not Available |
| Enzyme 1 GenAtlas ID |
Not Available |
| Enzyme 1 HGNC ID |
Not Available |
| Enzyme 1 Chromosome Location |
Not Available |
| Enzyme 1 Locus |
Not Available |
| Enzyme 1 SNPs |
SNPJam Report  |
| Enzyme 1 General References |
Not Available |
| Enzyme 1 Metabolite References |
Not Available |
|
Enzyme 2
[top]
|
| Enzyme 2 ID |
16329 |
| Enzyme 2 Name |
Riboflavin synthase alpha chain |
| Enzyme 2 Synonyms |
Not Available |
| Enzyme 2 Gene Name |
Not Available |
| Enzyme 2 Protein Sequence |
>Riboflavin synthase alpha chain
MFSGIVEEYATVVALVKDQENIHFTLKCSFVNELKIDQSISHNGVCLTVVSMTEDTYTVT
AMKETLDRSNLRLLKVGDKVNVERSMMMNGRLDGHIVQGHVDQTAECIDIKDADGSWYFT
FKYAFDKEMAKRGYITVDKGSVTVNGVSLTVCNPTDDTFQVAIIPYTYEHTNFHTFGKGS
VVNLEFDIIGKYISRMIQYK
|
| Enzyme 2 Number of Residues |
200 |
| Enzyme 2 Molecular Weight |
22597 |
| Enzyme 2 Theoretical pI |
5.59 |
| Enzyme 2 GO Classification |
Not Available |
| Enzyme 2 General Function |
Coenzyme transport and metabolism |
| Enzyme 2 Specific Function |
Not Available |
| Enzyme 2 Pathways |
Not Available |
| Enzyme 2 Reactions |
Not Available |
| Enzyme 2 Pfam Domain Function |
|
| Enzyme 2 Signals |
|
| Enzyme 2 Transmembrane Regions |
|
| Enzyme 2 Essentiality |
Not Available |
| Enzyme 2 GenBank ID Protein |
Not Available |
| Enzyme 2 UniProtKB/Swiss-Prot ID |
Q64SM7  |
| Enzyme 2 UniProtKB/Swiss-Prot Entry Name |
Q64SM7_BACFR  |
| Enzyme 2 PDB ID |
Not Available |
| Enzyme 2 Cellular Location |
Not Available |
| Enzyme 2 Gene Sequence |
Not Available |
| Enzyme 2 GenBank Gene ID |
AP006841  |
| Enzyme 2 GeneCard ID |
Not Available |
| Enzyme 2 GenAtlas ID |
Not Available |
| Enzyme 2 HGNC ID |
Not Available |
| Enzyme 2 Chromosome Location |
Not Available |
| Enzyme 2 Locus |
Not Available |
| Enzyme 2 SNPs |
Not Available |
| Enzyme 2 General References |
Not Available |
| Enzyme 2 Metabolite References |
Not Available |
|
Enzyme 3
[top]
|
| Enzyme 3 ID |
16330 |
| Enzyme 3 Name |
Riboflavin synthase alpha chain (EC 2.5.1.9) |
| Enzyme 3 Synonyms |
Not Available |
| Enzyme 3 Gene Name |
ribB |
| Enzyme 3 Protein Sequence |
>Riboflavin synthase alpha chain (EC 2.5.1.9)
MFTGIVEEVGILRKITANGKSGKVTILSNKILDGTNLGDSIAVNGVCLTVSNLGKNEFTA
DVMMETIRSTNLGLLNANDKVNLERAMSLSSRFGGHIVTGHVDGKGTICKFEKDENAVLV
SIRPDKKLLSSMILKGSVAIDGVSLTISYLDDEIFKVSIIPHTKINTILLTKNVGDFVNL
ESDVIGKYVNNFMANNYKELNSNSSNHKSNIDKDFLFKNGF
|
| Enzyme 3 Number of Residues |
221 |
| Enzyme 3 Molecular Weight |
24033 |
| Enzyme 3 Theoretical pI |
8.22 |
| Enzyme 3 GO Classification |
Not Available |
| Enzyme 3 General Function |
Coenzyme transport and metabolism |
| Enzyme 3 Specific Function |
Not Available |
| Enzyme 3 Pathways |
Not Available |
| Enzyme 3 Reactions |
- 2 6,7-dimethyl-8-(1-D-ribityl)lumazine = riboflavin + 4-(1-D-ribitylamino)-5-amino-2,6-dihydroxypyrimidine [RN:R00066] ALL_REAC R00066
|
| Enzyme 3 Pfam Domain Function |
|
| Enzyme 3 Signals |
|
| Enzyme 3 Transmembrane Regions |
|
| Enzyme 3 Essentiality |
Not Available |
| Enzyme 3 GenBank ID Protein |
Not Available |
| Enzyme 3 UniProtKB/Swiss-Prot ID |
Q186Q6  |
| Enzyme 3 UniProtKB/Swiss-Prot Entry Name |
Q186Q6_CLOD6  |
| Enzyme 3 PDB ID |
Not Available |
| Enzyme 3 Cellular Location |
Not Available |
| Enzyme 3 Gene Sequence |
Not Available |
| Enzyme 3 GenBank Gene ID |
AM180355  |
| Enzyme 3 GeneCard ID |
Not Available |
| Enzyme 3 GenAtlas ID |
Not Available |
| Enzyme 3 HGNC ID |
Not Available |
| Enzyme 3 Chromosome Location |
Not Available |
| Enzyme 3 Locus |
Not Available |
| Enzyme 3 SNPs |
SNPJam Report  |
| Enzyme 3 General References |
Not Available |
| Enzyme 3 Metabolite References |
Not Available |
|
Enzyme 4
[top]
|
| Enzyme 4 ID |
16331 |
| Enzyme 4 Name |
Riboflavin synthase alpha subunit |
| Enzyme 4 Synonyms |
Not Available |
| Enzyme 4 Gene Name |
risA |
| Enzyme 4 Protein Sequence |
>Riboflavin synthase alpha subunit
MFTGIVEEIGEVISIDKNEKSSLLKIRANKVLEDTKIGDSISTNGVCLTITTKGKDYFTA
YVMGETLRKSNIGNLKKSSKVNLERAMSINSRFNGHIVTGHIDSTGEIISFKDEGEAIWV
EIKVSYELSKYIVYKGSIAIDGISLTIAEVKGESFKVSVIPHSQEETTLTKRKIGDLVNI
ECDPIGKYVEKLLGFNKDNRKKKSVLTEEFLTINGFI
|
| Enzyme 4 Number of Residues |
217 |
| Enzyme 4 Molecular Weight |
24090 |
| Enzyme 4 Theoretical pI |
8.19 |
| Enzyme 4 GO Classification |
Not Available |
| Enzyme 4 General Function |
Coenzyme transport and metabolism |
| Enzyme 4 Specific Function |
Not Available |
| Enzyme 4 Pathways |
Not Available |
| Enzyme 4 Reactions |
Not Available |
| Enzyme 4 Pfam Domain Function |
|
| Enzyme 4 Signals |
|
| Enzyme 4 Transmembrane Regions |
|
| Enzyme 4 Essentiality |
Not Available |
| Enzyme 4 GenBank ID Protein |
Not Available |
| Enzyme 4 UniProtKB/Swiss-Prot ID |
Q8XMX1  |
| Enzyme 4 UniProtKB/Swiss-Prot Entry Name |
Q8XMX1_CLOPE  |
| Enzyme 4 PDB ID |
Not Available |
| Enzyme 4 Cellular Location |
Not Available |
| Enzyme 4 Gene Sequence |
Not Available |
| Enzyme 4 GenBank Gene ID |
BA000016  |
| Enzyme 4 GeneCard ID |
Not Available |
| Enzyme 4 GenAtlas ID |
Not Available |
| Enzyme 4 HGNC ID |
Not Available |
| Enzyme 4 Chromosome Location |
Not Available |
| Enzyme 4 Locus |
Not Available |
| Enzyme 4 SNPs |
SNPJam Report  |
| Enzyme 4 General References |
- Shimizu T, Ohtani K, Hirakawa H, Ohshima K, Yamashita A, Shiba T, Ogasawara N, Hattori M, Kuhara S, Hayashi H: Complete genome sequence of Clostridium perfringens, an anaerobic flesh-eater. Proc Natl Acad Sci U S A. 2002 Jan 22;99(2):996-1001. Epub 2002 Jan 15. [PubMed
]
|
| Enzyme 4 Metabolite References |
Not Available |
|
Enzyme 5
[top]
|
| Enzyme 5 ID |
16332 |
| Enzyme 5 Name |
Riboflavin synthase, alpha subunit (EC 2.5.1.9) |
| Enzyme 5 Synonyms |
Not Available |
| Enzyme 5 Gene Name |
ribE |
| Enzyme 5 Protein Sequence |
>Riboflavin synthase, alpha subunit (EC 2.5.1.9)
MFTGIVEEIGEVISIDKNEKSSLLKIRANKVLEDTKIGDSISTNGVCLTITTKGKDYFTA
YVMGETLRKSNLGNLKKSSKVNLERAMSINGRFNGHIVTGHIDSTGEIISFKDEGEAIWV
EIKVSYELSKYIVYKGSIAIDGISLTIAEVKGESFKVSVIPHSQEETTLTKRKIGDLVNI
ECDSIGKYVEKLLGFKKDSRKKKSVLTEEFLTINGFI
|
| Enzyme 5 Number of Residues |
217 |
| Enzyme 5 Molecular Weight |
24037 |
| Enzyme 5 Theoretical pI |
8.63 |
| Enzyme 5 GO Classification |
Not Available |
| Enzyme 5 General Function |
Coenzyme transport and metabolism |
| Enzyme 5 Specific Function |
Not Available |
| Enzyme 5 Pathways |
Not Available |
| Enzyme 5 Reactions |
- 2 6,7-dimethyl-8-(1-D-ribityl)lumazine = riboflavin + 4-(1-D-ribitylamino)-5-amino-2,6-dihydroxypyrimidine [RN:R00066] ALL_REAC R00066
|
| Enzyme 5 Pfam Domain Function |
|
| Enzyme 5 Signals |
|
| Enzyme 5 Transmembrane Regions |
|
| Enzyme 5 Essentiality |
Not Available |
| Enzyme 5 GenBank ID Protein |
Not Available |
| Enzyme 5 UniProtKB/Swiss-Prot ID |
Q0TTN9  |
| Enzyme 5 UniProtKB/Swiss-Prot Entry Name |
Q0TTN9_CLOP1  |
| Enzyme 5 PDB ID |
Not Available |
| Enzyme 5 Cellular Location |
Not Available |
| Enzyme 5 Gene Sequence |
Not Available |
| Enzyme 5 GenBank Gene ID |
CP000246  |
| Enzyme 5 GeneCard ID |
Not Available |
| Enzyme 5 GenAtlas ID |
Not Available |
| Enzyme 5 HGNC ID |
Not Available |
| Enzyme 5 Chromosome Location |
Not Available |
| Enzyme 5 Locus |
Not Available |
| Enzyme 5 SNPs |
SNPJam Report  |
| Enzyme 5 General References |
Not Available |
| Enzyme 5 Metabolite References |
Not Available |
|
Enzyme 6
[top]
|
| Enzyme 6 ID |
16333 |
| Enzyme 6 Name |
Riboflavin synthase, alpha subunit (EC 2.5.1.9) |
| Enzyme 6 Synonyms |
Not Available |
| Enzyme 6 Gene Name |
ribE |
| Enzyme 6 Protein Sequence |
>Riboflavin synthase, alpha subunit (EC 2.5.1.9)
MFTGIVEEIGEVISIDKNEKSSLLKIRANKVLEDTKIGDSISTNGVCLTITTKGKDYFTA
YVMGETLRKSNLGNLKKSSKVNLERAMSINGRFNGHIVTGHIDSTGEIISFKDEGEAIWV
EIKVSYELSKYIVYKGSIAIDGISLTIAEVKGESFKVSVIPHSQEETTLTKRKIGDLVNI
ECDPIGKYVEKLLGFKKDSRKKKSVLTEEFLTINGFI
|
| Enzyme 6 Number of Residues |
217 |
| Enzyme 6 Molecular Weight |
24047 |
| Enzyme 6 Theoretical pI |
8.63 |
| Enzyme 6 GO Classification |
Not Available |
| Enzyme 6 General Function |
Coenzyme transport and metabolism |
| Enzyme 6 Specific Function |
Not Available |
| Enzyme 6 Pathways |
Not Available |
| Enzyme 6 Reactions |
- 2 6,7-dimethyl-8-(1-D-ribityl)lumazine = riboflavin + 4-(1-D-ribitylamino)-5-amino-2,6-dihydroxypyrimidine [RN:R00066] ALL_REAC R00066
|
| Enzyme 6 Pfam Domain Function |
|
| Enzyme 6 Signals |
|
| Enzyme 6 Transmembrane Regions |
|
| Enzyme 6 Essentiality |
Not Available |
| Enzyme 6 GenBank ID Protein |
Not Available |
| Enzyme 6 UniProtKB/Swiss-Prot ID |
Q0SVJ1  |
| Enzyme 6 UniProtKB/Swiss-Prot Entry Name |
Q0SVJ1_CLOPS  |
| Enzyme 6 PDB ID |
Not Available |
| Enzyme 6 Cellular Location |
Not Available |
| Enzyme 6 Gene Sequence |
Not Available |
| Enzyme 6 GenBank Gene ID |
CP000312  |
| Enzyme 6 GeneCard ID |
Not Available |
| Enzyme 6 GenAtlas ID |
Not Available |
| Enzyme 6 HGNC ID |
Not Available |
| Enzyme 6 Chromosome Location |
Not Available |
| Enzyme 6 Locus |
Not Available |
| Enzyme 6 SNPs |
SNPJam Report  |
| Enzyme 6 General References |
Not Available |
| Enzyme 6 Metabolite References |
Not Available |
|
Enzyme 7
[top]
|
| Enzyme 7 ID |
16334 |
| Enzyme 7 Name |
Riboflavin synthase alpha chain |
| Enzyme 7 Synonyms |
Not Available |
| Enzyme 7 Gene Name |
ribE |
| Enzyme 7 Protein Sequence |
>Riboflavin synthase alpha chain
MFTGIVQGTAKLVSIDEKPNFRTHVVELPDHMLDGLETGASVAHNGCCLTVTEINGNHVS
FDLMKETLRITNLGDLKVGDWVNVERAAKFSDEIGGHLMSGHIMTTAEVAKILTSENNRQ
IWFKVQDSQLMKYILYKGFIGIDGISLTVGEVTPTRFCVHLIPETLERTTLGKKKLGARV
NIEIDPQTQAVVDTVERVLAARENAMNQPGTEA
|
| Enzyme 7 Number of Residues |
213 |
| Enzyme 7 Molecular Weight |
23445 |
| Enzyme 7 Theoretical pI |
5.88 |
| Enzyme 7 GO Classification |
Not Available |
| Enzyme 7 General Function |
Coenzyme transport and metabolism |
| Enzyme 7 Specific Function |
Riboflavin synthase is a bifunctional enzyme complex catalyzing the formation of riboflavin from 5-amino-6-(1'-D)- ribityl-amino-2,4(1H,3H)-pyrimidinedione and L-3,4-dihydrohy-2- butanone-4-phosphate via 6,7-dimethyl-8-lumazine. The alpha subunit catalyzes the dismutation of 6,7-dimethyl-8-lumazine to riboflavin and 5-amino-6-(1'-D)-ribityl-amino-2,4(1H,3H)- pyrimidinedione |
| Enzyme 7 Pathways |
Not Available |
| Enzyme 7 Reactions |
Not Available |
| Enzyme 7 Pfam Domain Function |
|
| Enzyme 7 Signals |
|
| Enzyme 7 Transmembrane Regions |
|
| Enzyme 7 Essentiality |
Not Available |
| Enzyme 7 GenBank ID Protein |
Not Available |
| Enzyme 7 UniProtKB/Swiss-Prot ID |
P0AFU8  |
| Enzyme 7 UniProtKB/Swiss-Prot Entry Name |
RISA_ECOLI  |
| Enzyme 7 PDB ID |
1I8D  |
| Enzyme 7 PDB File |
Show |
| Enzyme 7 3D Structure |
|
| Enzyme 7 Cellular Location |
Not Available |
| Enzyme 7 Gene Sequence |
Not Available |
| Enzyme 7 GenBank Gene ID |
X69109  |
| Enzyme 7 GeneCard ID |
Not Available |
| Enzyme 7 GenAtlas ID |
Not Available |
| Enzyme 7 HGNC ID |
Not Available |
| Enzyme 7 Chromosome Location |
Not Available |
| Enzyme 7 Locus |
Not Available |
| Enzyme 7 SNPs |
SNPJam Report  |
| Enzyme 7 General References |
- Eberhardt S, Richter G, Gimbel W, Werner T, Bacher A: Cloning, sequencing, mapping and hyperexpression of the ribC gene coding for riboflavin synthase of Escherichia coli. Eur J Biochem. 1996 Dec 15;242(3):712-9. [PubMed
]
- Hensel M, Shea JE, Baumler AJ, Gleeson C, Blattner F, Holden DW: Analysis of the boundaries of Salmonella pathogenicity island 2 and the corresponding chromosomal region of Escherichia coli K-12. J Bacteriol. 1997 Feb;179(4):1105-11. [PubMed
]
- Aiba H, Baba T, Hayashi K, Inada T, Isono K, Itoh T, Kasai H, Kashimoto K, Kimura S, Kitakawa M, Kitagawa M, Makino K, Miki T, Mizobuchi K, Mori H, Mori T, Motomura K, Nakade S, Nakamura Y, Nashimoto H, Nishio Y, Oshima T, Saito N, Sampei G, Horiuchi T, et al.: A 570-kb DNA sequence of the Escherichia coli K-12 genome corresponding to the 28.0-40.1 min region on the linkage map. DNA Res. 1996 Dec 31;3(6):363-77. [PubMed
]
- Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y: The complete genome sequence of Escherichia coli K-12. Science. 1997 Sep 5;277(5331):1453-74. [PubMed
]
- Liao DI, Wawrzak Z, Calabrese JC, Viitanen PV, Jordan DB: Crystal structure of riboflavin synthase. Structure. 2001 May 9;9(5):399-408. [PubMed
]
|
| Enzyme 7 Metabolite References |
Not Available |
|
Enzyme 8
[top]
|
| Enzyme 8 ID |
16835 |
| Enzyme 8 Name |
Riboflavin synthase, alpha subunit |
| Enzyme 8 Synonyms |
Not Available |
| Enzyme 8 Gene Name |
ribC |
| Enzyme 8 Protein Sequence |
>Riboflavin synthase, alpha subunit
MFTGIVQGTAKLVSIDEKPNFRTHVVELPDHMLDGLETGASVAHNGCCLTVTEINGNHVS
FDLMKETLRITNLGDLKVGDWVNVERAAKFSDEIGGHLMSGHIMTTAEVAKILTSENNRQ
IWFKVQDSQLMKYILYKGFIGIDGISLTVGEVTPTRFCVHLIPETLERTTLGKKKLGARV
NIEIDPQTQAVVDTVERVLAARENAMNQPGTEA
|
| Enzyme 8 Number of Residues |
213 |
| Enzyme 8 Molecular Weight |
23445 |
| Enzyme 8 Theoretical pI |
5.88 |
| Enzyme 8 GO Classification |
Not Available |
| Enzyme 8 General Function |
Coenzyme transport and metabolism |
| Enzyme 8 Specific Function |
Not Available |
| Enzyme 8 Pathways |
Not Available |
| Enzyme 8 Reactions |
Not Available |
| Enzyme 8 Pfam Domain Function |
|
| Enzyme 8 Signals |
|
| Enzyme 8 Transmembrane Regions |
|
| Enzyme 8 Essentiality |
Not Available |
| Enzyme 8 GenBank ID Protein |
Not Available |
| Enzyme 8 UniProtKB/Swiss-Prot ID |
B1XFX2  |
| Enzyme 8 UniProtKB/Swiss-Prot Entry Name |
B1XFX2_ECODH  |
| Enzyme 8 PDB ID |
1I8D  |
| Enzyme 8 PDB File |
Show |
| Enzyme 8 3D Structure |
|
| Enzyme 8 Cellular Location |
Not Available |
| Enzyme 8 Gene Sequence |
Not Available |
| Enzyme 8 GenBank Gene ID |
CP000948  |
| Enzyme 8 GeneCard ID |
Not Available |
| Enzyme 8 GenAtlas ID |
Not Available |
| Enzyme 8 HGNC ID |
Not Available |
| Enzyme 8 Chromosome Location |
Not Available |
| Enzyme 8 Locus |
Not Available |
| Enzyme 8 SNPs |
SNPJam Report  |
| Enzyme 8 General References |
Not Available |
| Enzyme 8 Metabolite References |
Not Available |