| Version |
2.5 |
| Creation Date |
2007-05-23 12:20:02 |
| Update Date |
2011-01-20 10:25:31 |
| Accession Number |
HMDB06483 |
| Secondary Accession Numbers |
Not Available |
| Common Name |
D-Aspartic acid |
| Description |
D-Aspartic acid is the D-isomer of aspartic acid. Since its discovery in invertebrates, free D-aspartate (D-Asp) has been identified in a variety of organisms, including microorganisms, plants, and lower animals, mammals and humans. D-Asp in mammalian tissues is present in specific cells, indicating the existence of specific molecular components that regulate D-Asp levels and localization in tissues. In the rat adrenal medulla, D-Asp is closely associated with adrenaline-cells (A-cells), which account for approximately 80% of the total number of chromaffin cells in the tissue, and which make and store adrenaline. D-Asp appears to be absent from noradrenaline-cells (NA-cells), which comprise approximately 20% of the total number of chromaffin cells in the adrenal medulla, and which make and store noradrenaline. D-aspartate oxidase (EC 1.4.3.1, D-AspO), which catalyzes oxidative deamination of D-Asp, appears to be present only in NA-cells, suggesting that the lack of D-Asp in these cells is due to D-Asp oxidase-mediated metabolism of D-Asp. In the rat adrenal cortex, the distribution of D-Asp changes during development. It has been suggested that developmental changes in the localization of D-Asp reflects the participation of D-Asp in the development and maturation of steroidogenesis in rat adrenal cortical cells. D-Asp is involved in steroid hormone synthesis and secretion in mammals as well. D-Asp is synthesized intracellularly, most likely by Asp racemase (EC 5.1.1.13). Endogenous D-Asp apparently has two different intracellular localization patterns: cytoplasmic and vesicular. D-Asp release can occur through three distinct pathways: 1) spontaneous, continuous release of cytoplasmic D-Asp, which is not associated with a specific stimulus; 2) release of cytoplasmic D-Asp via a volume-sensitive organic anion channel that connects the cytoplasm and extracellular space; 3) exocytotic discharge of vesicular D-Asp. D-Asp can be released via a mechanism that involves the L-Glu transporter. D-Asp is thus apparently in dynamic flux at the cellular level to carry out its physiological function(s) in mammals. (PMID: 16755369) |
| Synonyms |
- (-)-Aspartic acid
- (2R)-2-Aminobutanedioic acid
- (R)-2-Aminobutanedioic acid
- (R)-2-Aminosuccinic acid
- (R)-Aspartic acid
- 1-Amino-1,2-carboxyethane
- aspartic acid
- D-(-)-Aspartic acid
- D-aspartate
- D-Asparaginsaeure
- D-aspartic acid
- delta-asparaginsaeure
- delta-aspartic acid
- Lopac-alpha-9256
- Tocris-0213
- delta-(-)-Aspartic acid
- (2R)-2-Aminobutanedioate
- (R)-2-Aminobutanedioate
- delta-aspartate
|
| Chemical IUPAC Name |
(2R)-2-aminobutanedioic acid |
| Chemical Formula |
C4H7NO4 |
| Chemical Structure |
 |
| Chemical Taxonomy |
| Kingdom |
|
| Super Class |
- Amino acids and Amino Acid conjugates
|
| Class |
|
| Sub Class |
|
| Family |
|
| Species |
- primary amine
- primary aliphatic amine (alkylamine)
- carboxylic acid
- alpha-aminoacid
|
| Biofunction |
- Protein synthesis, amino acid biosynthesis
|
| Application |
| — |
| Source |
|
|
| Average Molecular Weight |
133.103 |
| Monoisotopic Molecular Weight |
133.037506 |
| Isomeric SMILES |
N[C@H](CC(O)=O)C(O)=O |
| Canonical SMILES |
NC(CC(O)=O)C(O)=O |
| KEGG Compound ID |
C00402  |
| BioCyc ID |
CPD-302  |
| BiGG ID |
34874  |
| Wikipedia Link |
ASP  |
| NuGOwiki Link |
HMDB06483  |
| Metagene Link |
HMDB06483  |
| METLIN ID |
15  |
| PubChem Compound |
83887  |
| PubChem Substance |
11110794  |
| ChEBI ID |
17364  |
| CAS Registry Number |
1783-96-6 |
| InChI Identifier |
InChI=1/C4H7NO4/c5-2(4(8)9)1-3(6)7/h2H,1,5H2,(H,6,7)(H,8,9)/t2-/m1/s1 |
| Synthesis Reference |
Harada, Kaoru. Direct resolution of DL-aspartic acid with an optically active amine. Bulletin of the Chemical Society of Japan (1964), 37(9), 1383-4. |
| Melting Point (Experimental) |
Not Available |
| Experimental Water Solubility |
Not Available
Source: PhysProp
|
| Predicted Water Solubility |
142.0 mg/mL [Predicted by ALOGPS]
Calculated using ALOGPS
|
| Physiological Charge |
-1 |
| State |
Solid |
| Experimental LogP/Hydrophobicity |
Not Available
Source: PhysProp
|
| Predicted LogP/Hydrophobicity |
-3.52 [Predicted by ALOGPS]; -3.7 [Predicted by PubChem via XLOGP]
Calculated using ALOGPS
|
| Material Safety Data Sheet (MSDS) |
|
| MOL File |
Show  |
| SDF File |
Show  |
| PDB File |
Show  |
| 2D Structure |
|
| 3D Structure |
|
| Experimental PDB ID |
Not Available |
| Experimental 1H NMR Spectrum |
Not Available |
| Experimental 13C NMR Spectrum |
Not Available |
| Experimental 13C HSQC Spectrum |
Not Available |
| Predicted 1H NMR Spectrum |
Show Image Show Peaklist
|
| Predicted 13C NMR Spectrum |
Show Image Show Peaklist
|
| Mass Spectrum |
Not Available |
| Simplified TOCSY Spectrum |
Not Available |
| BMRB Spectrum |
Not Available |
| Cellular Location |
- Cytoplasm
- Extracellular
- peroxisome
|
| Biofluid Location |
|
| Tissue Location |
Not Available |
| Concentrations (Normal) |
| Biofluid |
Blood |
| Value |
16.0 +/- 3.0 uM |
| Age |
Children:1-13 yrs old |
| Sex |
N/A |
| Patient information |
Normal |
| Comments |
Not Available |
| References |
- Geigy Scientific Tables, 8th Rev edition, pp. 93. Edited by C. Lentner, West Cadwell, N.J.: Medical education Div., Ciba-Geigy Corp., Basel, Switzerland c1981-1992.
|
| Biofluid |
Blood |
| Value |
21.0 +/- 5.0 uM |
| Age |
Adult:>18 yrs old |
| Sex |
Male |
| Patient information |
Male |
| Comments |
Not Available |
| References |
- Geigy Scientific Tables, 8th Rev edition, pp. 93. Edited by C. Lentner, West Cadwell, N.J.: Medical education Div., Ciba-Geigy Corp., Basel, Switzerland c1981-1992.
|
| Biofluid |
Blood |
| Value |
20.0 +/- 5.0 uM |
| Age |
Adult:>18 yrs old |
| Sex |
Female |
| Patient information |
Female |
| Comments |
Not Available |
| References |
- Geigy Scientific Tables, 8th Rev edition, pp. 93. Edited by C. Lentner, West Cadwell, N.J.: Medical education Div., Ciba-Geigy Corp., Basel, Switzerland c1981-1992.
|
|
| Concentrations (Abnormal) |
Not Available |
| Associated Disorders |
Not Available |
| OMIM ID |
Not Available |
| Pathways |
|
| General References |
- Wikipedia

|
| Metabolic Enzymes |
- OTTHUMP00000017001
|
|
Enzyme 1
[top]
|
| Enzyme 1 ID |
8855 |
| Enzyme 1 Name |
OTTHUMP00000017001 |
| Enzyme 1 Synonyms |
Not Available |
| Enzyme 1 Gene Name |
DDO |
| Enzyme 1 Protein Sequence |
>OTTHUMP00000017001
MRPARHWETRFGARDFGGFQDCFFRDRLMDTARIAVVGAGVVGLSTAVCISKLVPRCSVT
IISDKFTPDTTSDVAAGMLIPHTYPDTPIHTQKQWFRETFNHLFAIANSAEAGDAGVHLV
SGWQIFQSTPTEEVPFWADVVLGFRKMTEAELKKFPQYVFGQAFTTLKCECPAYLPWLEK
RIKGSGGWTLTRRIEDLWELHPSFDIVVNCSGLGSRQLAGDSKIFPVRGQVLQVQAPWVE
HFIRDGSGLTYIYPGTSHVTLGGTRQKGDWNLSPDAENSREILSRCCALEPSLHGACNIR
EKVGLRPYRPGVRLQTELLARDGQRLPVVHHYGHGSGGISVHWGTALEAARLVSECVHAL
RTPIPKSNL
|
| Enzyme 1 Number of Residues |
369 |
| Enzyme 1 Molecular Weight |
40993 |
| Enzyme 1 Theoretical pI |
8.28 |
| Enzyme 1 GO Classification |
| Function |
- D-amino-acid oxidase activity
- catalytic activity
- oxidoreductase activity
- oxidoreductase activity, acting on the CH-NH2 group of donors
- oxidoreductase activity, acting on the CH-NH2 group of donors, oxygen as acceptor
|
| Process |
- cellular metabolism
- electron transport
- generation of precursor metabolites and energy
- metabolism
- physiological process
|
| Component |
| — |
|
| Enzyme 1 General Function |
Amino acid transport and metabolism |
| Enzyme 1 Specific Function |
Not Available |
| Enzyme 1 Pathways |
Not Available |
| Enzyme 1 Reactions |
Not Available |
| Enzyme 1 Pfam Domain Function |
|
| Enzyme 1 Signals |
Not Available |
| Enzyme 1 Transmembrane Regions |
Not Available |
| Enzyme 1 Essentiality |
Not Available |
| Enzyme 1 GenBank ID Protein |
57208418  |
| Enzyme 1 UniProtKB/Swiss-Prot ID |
Q5JXM5  |
| Enzyme 1 UniProtKB/Swiss-Prot Entry Name |
Q5JXM5_HUMAN  |
| Enzyme 1 PDB ID |
Not Available |
| Enzyme 1 Cellular Location |
Not Available |
| Enzyme 1 Gene Sequence |
>1110 bp
ATGAGACCAGCCAGGCACTGGGAAACAAGGTTTGGTGCCAGAGATTTTGGTGGCTTCCAA
GACTGCTTTTTCAGAGACAGGCTCATGGACACAGCACGGATTGCAGTTGTCGGGGCAGGT
GTGGTGGGGCTCTCCACGGCTGTGTGCATCTCCAAACTGGTGCCCCGATGCTCCGTTACC
ATCATTTCAGACAAGTTTACTCCAGATACCACCAGTGATGTGGCAGCCGGAATGCTTATT
CCTCACACTTATCCAGATACACCCATTCACACGCAGAAGCAGTGGTTCAGAGAAACCTTT
AATCACCTCTTTGCAATTGCCAATTCTGCAGAAGCTGGAGATGCTGGTGTTCATTTGGTA
TCAGGTTGGCAGATATTTCAGAGCACTCCGACTGAAGAAGTGCCATTCTGGGCTGACGTG
GTTCTGGGATTTCGAAAGATGACTGAGGCTGAGCTGAAGAAATTCCCCCAGTATGTGTTT
GGTCAGGCTTTTACAACCCTGAAATGTGAATGCCCTGCCTACCTCCCGTGGTTGGAGAAA
AGGATAAAGGGAAGTGGAGGCTGGACACTCACTCGGCGAATAGAAGACCTGTGGGAACTT
CATCCGTCCTTTGACATCGTGGTCAACTGTTCAGGCCTTGGAAGCAGACAGCTTGCAGGA
GACTCAAAGATTTTCCCTGTAAGGGGCCAAGTCCTCCAAGTTCAGGCTCCCTGGGTGGAG
CATTTTATCCGAGATGGCAGTGGGCTGACATATATTTATCCTGGTACATCCCATGTAACC
CTAGGTGGAACTAGGCAAAAAGGGGACTGGAATCTGTCCCCGGATGCAGAAAATAGCAGA
GAGATTCTTTCCCGATGCTGTGCTCTGGAGCCCTCCCTCCACGGAGCCTGCAACATCAGG
GAGAAGGTGGGCTTGAGGCCCTACAGGCCAGGCGTGCGACTGCAGACAGAGCTCCTTGCG
CGAGATGGACAGAGGCTGCCTGTAGTCCACCACTATGGCCATGGGAGTGGGGGCATCTCA
GTGCACTGGGGCACTGCTCTGGAGGCCGCCAGGCTGGTGAGCGAGTGTGTCCATGCCCTC
AGGACCCCCATTCCCAAGTCAAACCTGTAG
|
| Enzyme 1 GenBank Gene ID |
AL050350  |
| Enzyme 1 GeneCard ID |
DDO  |
| Enzyme 1 GenAtlas ID |
DDO  |
| Enzyme 1 HGNC ID |
HGNC:2727  |
| Enzyme 1 Chromosome Location |
6 |
| Enzyme 1 Locus |
6q21 |
| Enzyme 1 SNPs |
SNPJam Report  |
| Enzyme 1 General References |
Not Available |
| Enzyme 1 Metabolite References |
Not Available |