You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP00016
Secondary Accession Numbers
  • 5245
Name Malonyl-CoA decarboxylase, mitochondrial
Synonyms
  1. MCD
Gene Name MLYCD
Protein Type Enzyme
Biological Properties
General Function Involved in malonyl-CoA decarboxylase activity
Specific Function Catalyzes the conversion of malonyl-CoA to acetyl-CoA. In the fatty acid biosynthesis MCD selectively removes malonyl-CoA and thus assures that methyl-malonyl-CoA is the only chain elongating substrate for fatty acid synthase and that fatty acids with multiple methyl side chains are produced. In peroxisomes it may be involved in degrading intraperoxisomal malonyl-CoA, which is generated by the peroxisomal beta-oxidation of odd chain-length dicarboxylic fatty acids.
Pathways
  • acetyl-CoA biosynthesis
  • beta-Alanine metabolism
  • Malonic Aciduria
  • Malonyl-coa decarboxylase deficiency
  • Methylmalonic Aciduria Due to Cobalamin-Related Disorders
  • Peroxisome
  • Propanoate Metabolism
  • Propanoate metabolism
Reactions
Malonyl-CoA → Acetyl-CoA + CO(2) details
Malonyl-CoA → Acetyl-CoA + Carbon dioxide details
GO Classification
Biological Process
malonyl-CoA catabolic process
positive regulation of fatty acid oxidation
regulation of fatty acid beta-oxidation
regulation of glucose metabolic process
fatty acid oxidation
acetyl-CoA biosynthetic process
fatty acid biosynthetic process
Cellular Component
cytosol
mitochondrion
peroxisome
Function
catalytic activity
lyase activity
carbon-carbon lyase activity
carboxy-lyase activity
malonyl-coa decarboxylase activity
Molecular Function
malonyl-CoA decarboxylase activity
Process
metabolic process
cellular metabolic process
organic acid metabolic process
oxoacid metabolic process
carboxylic acid metabolic process
monocarboxylic acid metabolic process
fatty acid metabolic process
fatty acid biosynthetic process
Cellular Location
  1. Cytoplasm
  2. Mitochondrion
  3. Peroxisome
Gene Properties
Chromosome Location 16
Locus 16q24
SNPs MLYCD
Gene Sequence
>1482 bp
ATGCGAGGCTTCGGGCCAGGCTTGACGGCCAGGCGTCTCCTCCCGCTGCGGTTGCCCCCG
CGGCCGCCCGGGCCCCGGCTGGCGAGCGGGCAGGCGGCCGGCGCCCTGGAGCGGGCCATG
GACGAGCTGCTGCGCCGCGCGGTGCCGCCGACGCCGGCCTACGAGCTGCGCGAGAAGACA
CCGGCGCCCGCCGAGGGTCAGTGCGCGGACTTCGTGAGCTTCTACGGTGGGCTGGCCGAG
ACGGCCCAGCGGGCCGAACTGCTGGGCCGCCTGGCGCGGGGCTTCGGCGTGGACCACGGC
CAGGTGGCGGAGCAGAGCGCCGGCGTGCTCCATCTGCGCCAGCAGCAGCGGGAGTCGGCG
GTGCTGCTGCAGGCCGAGGTCCGGCTGCGCTACGCGCTGGTGCCGCGCTATCGCGGCCTC
TTCCACCACATCAGCAAGCTGGACGGCGGCGTGCGCTTCCTGGTGCAGCTGCGGGCCGAC
CTGCTGGAGGCGCAGGCCCTCAAGCTGGTGGAGGGGCCGGACGTCCGGGAAATGAATGGG
GTGCTGAAAGGAATGCTCTCAGAATGGTTTTCCTCCGGGTTCCTGAACCTAGAACGGGTT
ACCTGGCATTCACCGTGTGAAGTGCTTCAGAAAATCAGTGAGGCTGAGGCTGTGCATCCT
GTAAAAAACTGGATGGACATGAAGCGCCGCGTTGGGCCCTACAGAAGGTGTTACTTCTTT
TCTCACTGTTCGACCCCTGGGGAGCCCCTGGTCGTTTTGCACGTGGCACTGACTGGTGAC
ATCTCCAGCAACATCCAGGCAATCGTGAAGGAACATCCTCCATCAGAAACAGAAGAGAAG
AACAAAATCACTGCTGCGATCTTTTATTCCATCAGCTTGACCCAGCAGGGACTCCAAGGG
GTGGAGCTGGGAACATTCCTCATAAAGCGAGTCGTCAAGGAGTTGCAGAGAGAGTTTCCT
CACCTTGGGGTGTTTTCAAGTCTGTCACCTATACCTGGTTTCACCAAATGGCTTCTGGGG
CTTCTGAACTCGCAAACGAAGGAGCATGGGAGGAATGAACTCTTTACAGATTCGGAATGT
AAGGAAATCTCGGAGATCACAGGTGGCCCCATTAACGAGACCCTCAAGCTCCTCCTCAGC
AGCAGCGAGTGGGTGCAGTCGGAGAAGCTGGTGCGGGCGCTGCAGACTCCGCTGATGAGG
CTGTGCGCCTGGTACCTGTATGGAGAGAAGCACCGCGGCTACGCGCTGAACCCCGTGGCC
AACTTCCACCTGCAGAACGGGGCGGTGCTGTGGCGCATCAACTGGATGGCGGATGTGAGC
CTCAGAGGCATCACCGGCTCCTGCGGCCTGATGGCCAACTACCGCTACTTCCTGGAGGAG
ACGGGCCCCAACAGCACCTCCTACCTCGGCTCCAAGATCATCAAAGCCTCTGAGCAGGTC
CTCAGCCTAGTGGCCCAGTTTCAAAAGAACAGCAAGCTCTGA
Protein Properties
Number of Residues 493
Molecular Weight 55002.94
Theoretical pI 8.959
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Malonyl-CoA decarboxylase, mitochondrial
MRGFGPGLTARRLLPLRLPPRPPGPRLASGQAAGALERAMDELLRRAVPPTPAYELREKT
PAPAEGQCADFVSFYGGLAETAQRAELLGRLARGFGVDHGQVAEQSAGVLHLRQQQREAA
VLLQAEDRLRYALVPRYRGLFHHISKLDGGVRFLVQLRADLLEAQALKLVEGPDVREMNG
VLKGMLSEWFSSGFLNLERVTWHSPCEVLQKISEAEAVHPVKNWMDMKRRVGPYRRCYFF
SHCSTPGEPLVVLHVALTGDISSNIQAIVKEHPPSETEEKNKITAAIFYSISLTQQGLQG
VELGTFLIKRVVKELQREFPHLGVFSSLSPIPGFTKWLLGLLNSQTKEHGRNELFTDSEC
KEISEITGGPINETLKLLLSSSEWVQSEKLVRALQTPLMRLCAWYLYGEKHRGYALNPVA
NFHLQNGAVLWRINWMADVSLRGITGSCGLMANYRYFLEETGPNSTSYLGSKIIKASEQV
LSLVAQFQKNSKL
GenBank ID Protein 5732237
UniProtKB/Swiss-Prot ID O95822
UniProtKB/Swiss-Prot Entry Name DCMC_HUMAN
PDB IDs
GenBank Gene ID AF090834
GeneCard ID MLYCD
GenAtlas ID MLYCD
HGNC ID HGNC:7150
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  3. FitzPatrick DR, Hill A, Tolmie JL, Thorburn DR, Christodoulou J: The molecular basis of malonyl-CoA decarboxylase deficiency. Am J Hum Genet. 1999 Aug;65(2):318-26. [PubMed:10417274 ]
  4. Sacksteder KA, Morrell JC, Wanders RJ, Matalon R, Gould SJ: MCD encodes peroxisomal and cytoplasmic forms of malonyl-CoA decarboxylase and is mutated in malonyl-CoA decarboxylase deficiency. J Biol Chem. 1999 Aug 27;274(35):24461-8. [PubMed:10455107 ]
  5. Gao J, Waber L, Bennett MJ, Gibson KM, Cohen JC: Cloning and mutational analysis of human malonyl-coenzyme A decarboxylase. J Lipid Res. 1999 Jan;40(1):178-82. [PubMed:9869665 ]