You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP00081
Secondary Accession Numbers
  • 5310
Name Phosphatidylethanolamine N-methyltransferase
Synonyms
  1. PEAMT
  2. PEMT
  3. PEMT2
Gene Name PEMT
Protein Type Unknown
Biological Properties
General Function Involved in N-methyltransferase activity
Specific Function Catalyzes three sequential methylation reactions of phosphatidylethanolamine (PE) by AdoMet, thereby producing phosphatidylcholine (PC).
Pathways
  • Betaine Metabolism
  • Glycerophospholipid metabolism
  • Phosphatidylcholine Biosynthesis
  • phosphatidylcholine biosynthesis
  • Phosphatidylcholine Biosynthesis PC(11D3/11D3)
  • Phosphatidylcholine Biosynthesis PC(11D3/11D5)
  • Phosphatidylcholine Biosynthesis PC(11D3/11M3)
  • Phosphatidylcholine Biosynthesis PC(11D3/11M5)
  • Phosphatidylcholine Biosynthesis PC(11D3/13D5)
  • Phosphatidylcholine Biosynthesis PC(11D3/13M5)
  • Phosphatidylcholine Biosynthesis PC(11D3/9D3)
  • Phosphatidylcholine Biosynthesis PC(11D3/9D5)
  • Phosphatidylcholine Biosynthesis PC(11D3/9M5)
  • Phosphatidylcholine Biosynthesis PC(11D5/11D3)
  • Phosphatidylcholine Biosynthesis PC(11D5/11D5)
  • Phosphatidylcholine Biosynthesis PC(11D5/11M3)
  • Phosphatidylcholine Biosynthesis PC(11D5/11M5)
  • Phosphatidylcholine Biosynthesis PC(11D5/13D5)
  • Phosphatidylcholine Biosynthesis PC(11D5/13M5)
  • Phosphatidylcholine Biosynthesis PC(11D5/9D3)
  • Phosphatidylcholine Biosynthesis PC(11D5/9D5)
  • Phosphatidylcholine Biosynthesis PC(11D5/9M5)
  • Phosphatidylcholine Biosynthesis PC(11M3/11D3)
  • Phosphatidylcholine Biosynthesis PC(11M3/11D5)
  • Phosphatidylcholine Biosynthesis PC(11M3/11M3)
  • Phosphatidylcholine Biosynthesis PC(11M3/11M5)
  • Phosphatidylcholine Biosynthesis PC(11M3/13D5)
  • Phosphatidylcholine Biosynthesis PC(11M3/13M5)
  • Phosphatidylcholine Biosynthesis PC(11M3/9D3)
  • Phosphatidylcholine Biosynthesis PC(11M3/9D5)
  • Phosphatidylcholine Biosynthesis PC(11M3/9M5)
  • Phosphatidylcholine Biosynthesis PC(11M5/11D3)
  • Phosphatidylcholine Biosynthesis PC(11M5/11D5)
  • Phosphatidylcholine Biosynthesis PC(11M5/11M3)
  • Phosphatidylcholine Biosynthesis PC(11M5/11M5)
  • Phosphatidylcholine Biosynthesis PC(11M5/13D5)
  • Phosphatidylcholine Biosynthesis PC(11M5/13M5)
  • Phosphatidylcholine Biosynthesis PC(11M5/9D3)
  • Phosphatidylcholine Biosynthesis PC(11M5/9D5)
  • Phosphatidylcholine Biosynthesis PC(11M5/9M5)
  • Phosphatidylcholine Biosynthesis PC(13D5/11D3)
  • Phosphatidylcholine Biosynthesis PC(13D5/11D5)
  • Phosphatidylcholine Biosynthesis PC(13D5/11M3)
  • Phosphatidylcholine Biosynthesis PC(13D5/11M5)
  • Phosphatidylcholine Biosynthesis PC(13D5/13D5)
  • Phosphatidylcholine Biosynthesis PC(13D5/13M5)
  • Phosphatidylcholine Biosynthesis PC(13D5/9D3)
  • Phosphatidylcholine Biosynthesis PC(13D5/9D5)
  • Phosphatidylcholine Biosynthesis PC(13D5/9M5)
  • Phosphatidylcholine Biosynthesis PC(13M5/11D3)
  • Phosphatidylcholine Biosynthesis PC(13M5/11D5)
  • Phosphatidylcholine Biosynthesis PC(13M5/11M3)
  • Phosphatidylcholine Biosynthesis PC(13M5/11M5)
  • Phosphatidylcholine Biosynthesis PC(13M5/13D5)
  • Phosphatidylcholine Biosynthesis PC(13M5/13M5)
  • Phosphatidylcholine Biosynthesis PC(13M5/9D3)
  • Phosphatidylcholine Biosynthesis PC(13M5/9D5)
  • Phosphatidylcholine Biosynthesis PC(13M5/9M5)
  • Phosphatidylcholine Biosynthesis PC(14:0/14:0)
  • Phosphatidylcholine Biosynthesis PC(14:0/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/15:0)
  • Phosphatidylcholine Biosynthesis PC(14:0/16:0)
  • Phosphatidylcholine Biosynthesis PC(14:0/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/18:0)
  • Phosphatidylcholine Biosynthesis PC(14:0/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/20:0)
  • Phosphatidylcholine Biosynthesis PC(14:0/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/22:0)
  • Phosphatidylcholine Biosynthesis PC(14:0/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/24:0)
  • Phosphatidylcholine Biosynthesis PC(14:0/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/14:0)
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/15:0)
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/16:0)
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/18:0)
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/14:0)
  • Phosphatidylcholine Biosynthesis PC(15:0/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/15:0)
  • Phosphatidylcholine Biosynthesis PC(15:0/16:0)
  • Phosphatidylcholine Biosynthesis PC(15:0/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/18:0)
  • Phosphatidylcholine Biosynthesis PC(15:0/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/20:0)
  • Phosphatidylcholine Biosynthesis PC(15:0/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/22:0)
  • Phosphatidylcholine Biosynthesis PC(15:0/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/24:0)
  • Phosphatidylcholine Biosynthesis PC(15:0/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/14:0)
  • Phosphatidylcholine Biosynthesis PC(16:0/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/15:0)
  • Phosphatidylcholine Biosynthesis PC(16:0/16:0)
  • Phosphatidylcholine Biosynthesis PC(16:0/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/18:0)
  • Phosphatidylcholine Biosynthesis PC(16:0/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/20:0)
  • Phosphatidylcholine Biosynthesis PC(16:0/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/22:0)
  • Phosphatidylcholine Biosynthesis PC(16:0/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/24:0)
  • Phosphatidylcholine Biosynthesis PC(16:0/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/14:0)
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/15:0)
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/16:0)
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/18:0)
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/14:0)
  • Phosphatidylcholine Biosynthesis PC(18:0/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/15:0)
  • Phosphatidylcholine Biosynthesis PC(18:0/16:0)
  • Phosphatidylcholine Biosynthesis PC(18:0/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/18:0)
  • Phosphatidylcholine Biosynthesis PC(18:0/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/20:0)
  • Phosphatidylcholine Biosynthesis PC(18:0/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/22:0)
  • Phosphatidylcholine Biosynthesis PC(18:0/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/24:0)
  • Phosphatidylcholine Biosynthesis PC(18:0/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/14:0)
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/15:0)
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/16:0)
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/18:0)
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/14:0)
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/15:0)
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/16:0)
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/18:0)
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/14:0)
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/15:0)
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/16:0)
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/18:0)
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/14:0)
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/15:0)
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/16:0)
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/18:0)
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/14:0)
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/15:0)
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/16:0)
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/18:0)
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/14:0)
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/15:0)
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/16:0)
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/18:0)
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/14:0)
  • Phosphatidylcholine Biosynthesis PC(20:0/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/15:0)
  • Phosphatidylcholine Biosynthesis PC(20:0/16:0)
  • Phosphatidylcholine Biosynthesis PC(20:0/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/18:0)
  • Phosphatidylcholine Biosynthesis PC(20:0/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/20:0)
  • Phosphatidylcholine Biosynthesis PC(20:0/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/22:0)
  • Phosphatidylcholine Biosynthesis PC(20:0/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/24:0)
  • Phosphatidylcholine Biosynthesis PC(20:0/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/14:0)
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/15:0)
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/16:0)
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/18:0)
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/14:0)
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/15:0)
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/16:0)
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/18:0)
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/14:0)
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/15:0)
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/16:0)
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/18:0)
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/14:0)
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/15:0)
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/16:0)
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/18:0)
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/14:0)
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/15:0)
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/16:0)
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/18:0)
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/14:0)
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/15:0)
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/16:0)
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/18:0)
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/14:0)
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/15:0)
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/16:0)
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/18:0)
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/14:0)
  • Phosphatidylcholine Biosynthesis PC(22:0/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/15:0)
  • Phosphatidylcholine Biosynthesis PC(22:0/16:0)
  • Phosphatidylcholine Biosynthesis PC(22:0/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/18:0)
  • Phosphatidylcholine Biosynthesis PC(22:0/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/20:0)
  • Phosphatidylcholine Biosynthesis PC(22:0/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/22:0)
  • Phosphatidylcholine Biosynthesis PC(22:0/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/24:0)
  • Phosphatidylcholine Biosynthesis PC(22:0/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/14:0)
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/15:0)
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/16:0)
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/18:0)
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/14:0)
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/15:0)
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/16:0)
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/18:0)
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/14:0)
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/15:0)
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/16:0)
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/18:0)
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/14:0)
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/15:0)
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/16:0)
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/18:0)
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/14:0)
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/15:0)
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/16:0)
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/18:0)
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/14:0)
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/15:0)
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:0)
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0)
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(24:0/14:0)
  • Phosphatidylcholine Biosynthesis PC(24:0/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(24:0/15:0)
  • Phosphatidylcholine Biosynthesis PC(24:0/16:0)
  • Phosphatidylcholine Biosynthesis PC(24:0/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(24:0/18:0)
  • Phosphatidylcholine Biosynthesis PC(24:0/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(24:0/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(24:0/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(24:0/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(24:0/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(24:0/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(24:0/20:0)
  • Phosphatidylcholine Biosynthesis PC(24:0/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(24:0/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(24:0/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(24:0/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(24:0/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(24:0/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(24:0/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(24:0/22:0)
  • Phosphatidylcholine Biosynthesis PC(24:0/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(24:0/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(24:0/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(24:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(24:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(24:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(24:0/24:0)
  • Phosphatidylcholine Biosynthesis PC(24:0/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/14:0)
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/15:0)
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/16:0)
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/18:0)
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(9D3/11D3)
  • Phosphatidylcholine Biosynthesis PC(9D3/11D5)
  • Phosphatidylcholine Biosynthesis PC(9D3/11M3)
  • Phosphatidylcholine Biosynthesis PC(9D3/11M5)
  • Phosphatidylcholine Biosynthesis PC(9D3/13D5)
  • Phosphatidylcholine Biosynthesis PC(9D3/13M5)
  • Phosphatidylcholine Biosynthesis PC(9D3/9D3)
  • Phosphatidylcholine Biosynthesis PC(9D3/9D5)
  • Phosphatidylcholine Biosynthesis PC(9D3/9M5)
  • Phosphatidylcholine Biosynthesis PC(9D5/11D3)
  • Phosphatidylcholine Biosynthesis PC(9D5/11D5)
  • Phosphatidylcholine Biosynthesis PC(9D5/11M3)
  • Phosphatidylcholine Biosynthesis PC(9D5/11M5)
  • Phosphatidylcholine Biosynthesis PC(9D5/13D5)
  • Phosphatidylcholine Biosynthesis PC(9D5/13M5)
  • Phosphatidylcholine Biosynthesis PC(9D5/9D3)
  • Phosphatidylcholine Biosynthesis PC(9D5/9D5)
  • Phosphatidylcholine Biosynthesis PC(9D5/9M5)
  • Phosphatidylcholine Biosynthesis PC(9M5/11D3)
  • Phosphatidylcholine Biosynthesis PC(9M5/11D5)
  • Phosphatidylcholine Biosynthesis PC(9M5/11M3)
  • Phosphatidylcholine Biosynthesis PC(9M5/11M5)
  • Phosphatidylcholine Biosynthesis PC(9M5/13D5)
  • Phosphatidylcholine Biosynthesis PC(9M5/13M5)
  • Phosphatidylcholine Biosynthesis PC(9M5/9D3)
  • Phosphatidylcholine Biosynthesis PC(9M5/9D5)
  • Phosphatidylcholine Biosynthesis PC(9M5/9M5)
  • Phospholipid Biosynthesis
Reactions
S-Adenosylmethionine + phosphatidyl-N-methylethanolamine → S-Adenosylhomocysteine + phosphatidyl-N-dimethylethanolamine details
S-Adenosylmethionine + phosphatidyl-N-dimethylethanolamine → S-Adenosylhomocysteine + phosphatidylcholine details
S-Adenosylmethionine + Phosphatidylethanolamine → S-Adenosylhomocysteine + phosphatidyl-N-methylethanolamine details
S-Adenosylmethionine + Phosphatidyl-N-dimethylethanolamine → S-Adenosylhomocysteine + Phosphatidylcholine details
S-Adenosylmethionine + Phosphatidylethanolamine → S-Adenosylhomocysteine + Phosphatidyl-N-methylethanolamine details
GO Classification
Biological Process
response to amino acid stimulus
cell proliferation
S-adenosylhomocysteine metabolic process
phosphatidylcholine biosynthetic process
response to drug
response to ethanol
S-adenosylmethionine metabolic process
response to vitamin
negative regulation of cell proliferation
positive regulation of lipoprotein metabolic process
Cellular Component
endoplasmic reticulum membrane
mitochondrial membrane
brush border membrane
integral to membrane
sarcolemma
Function
catalytic activity
transferase activity
transferase activity, transferring one-carbon groups
methyltransferase activity
n-methyltransferase activity
Molecular Function
phosphatidyl-N-dimethylethanolamine N-methyltransferase activity
phosphatidyl-N-methylethanolamine N-methyltransferase activity
phosphatidylethanolamine binding
phosphatidylethanolamine N-methyltransferase activity
Process
metabolic process
organophosphate metabolic process
phospholipid metabolic process
Cellular Location
  1. Multi-pass membrane protein (Potential)
  2. Multi-pass membrane protein (Potential)
  3. Endoplasmic reticulum membrane
  4. Mitochondrion membrane
Gene Properties
Chromosome Location 17
Locus 17p11.2
SNPs PEMT
Gene Sequence
>600 bp
ATGACCCGGCTGCTGGGCTACGTGGACCCCCTGGATCCCAGCTTTGTGGCTGCCGTCATC
ACCATCACCTTCAATCCGCTCTACTGGAATGTGGTTGCACGATGGGAACACAAGACCCGC
AAGCTGAGCAGGGCCTTCGGATCCCCCTACCTGGCCTGCTACTCTCTAAGCATCACCATC
CTGCTCCTGAACTTCCTGCGCTCGCACTGCTTCACGCAGGCCATGCTGAGCCAGCCCAGG
ATGGAGAGCCTGGACACCCCCGCGGCCTACAGCCTGGGCCTCGCGCTCCTGGGACTGGGC
GTCGTGCTCGTGCTCTCCAGCTTCTTTGCACTGGGGTTCGCTGGAACTTTCCTAGGTGAT
TACTTCGGGATCCTCAAGGAGGCGAGAGTGACCGTGTTCCCCTTCAACATCCTGGACAAC
CCCATGTACTGGGGAAGCACAGCCAACTACCTGGGCTGGGCCATCATGCACGCCAGCCCC
ACGGGCCTGCTCCTGACGGTGCTGGTGGCCCTCACCTACATAATGGCTCTCCTATACGAA
GAGCCCTTCACCGCTGAGATCTACCGGCAGAAAGCCTCCGGGTCCCACAAGAGGAGCTGA
Protein Properties
Number of Residues 199
Molecular Weight 23697.395
Theoretical pI 8.574
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Phosphatidylethanolamine N-methyltransferase
MTRLLGYVDPLDPSFVAAVITITFNPLYWNVVARWEHKTRKLSRAFGSPYLACYSLSVTI
LLLNFLRSHCFTQAMLSQPRMESLDTPAAYSLGLALLGLGVVLVLSSFFALGFAGTFLGD
YFGILKEARVTVFPFNILDNPMYWGSTANYLGWAIMHASPTGLLLTVLVALTYIVALLYE
EPFTAEIYRQKASGSHKRS
GenBank ID Protein 5459516
UniProtKB/Swiss-Prot ID Q9UBM1
UniProtKB/Swiss-Prot Entry Name PEMT_HUMAN
PDB IDs Not Available
GenBank Gene ID AB029821
GeneCard ID PEMT
GenAtlas ID PEMT
HGNC ID HGNC:8830
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Hu RM, Han ZG, Song HD, Peng YD, Huang QH, Ren SX, Gu YJ, Huang CH, Li YB, Jiang CL, Fu G, Zhang QH, Gu BW, Dai M, Mao YF, Gao GF, Rong R, Ye M, Zhou J, Xu SH, Gu J, Shi JX, Jin WR, Zhang CK, Wu TM, Huang GY, Chen Z, Chen MD, Chen JL: Gene expression profiling in the human hypothalamus-pituitary-adrenal axis and full-length cDNA cloning. Proc Natl Acad Sci U S A. 2000 Aug 15;97(17):9543-8. [PubMed:10931946 ]
  3. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  4. Walkey CJ, Shields DJ, Vance DE: Identification of three novel cDNAs for human phosphatidylethanolamine N-methyltransferase and localization of the human gene on chromosome 17p11.2. Biochim Biophys Acta. 1999 Jan 4;1436(3):405-12. [PubMed:9989271 ]
  5. Shields DJ, Agellon LB, Vance DE: Structure, expression profile and alternative processing of the human phosphatidylethanolamine N-methyltransferase (PEMT) gene. Biochim Biophys Acta. 2001 May 31;1532(1-2):105-14. [PubMed:11420179 ]
  6. Resseguie M, Song J, Niculescu MD, da Costa KA, Randall TA, Zeisel SH: Phosphatidylethanolamine N-methyltransferase (PEMT) gene expression is induced by estrogen in human and mouse primary hepatocytes. FASEB J. 2007 Aug;21(10):2622-32. Epub 2007 Apr 24. [PubMed:17456783 ]