You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP00163
Secondary Accession Numbers
  • 5395
  • HMDBP03456
Name NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial
Synonyms
  1. CI-SGDH
  2. Complex I-SGDH
  3. NADH-ubiquinone oxidoreductase SGDH subunit
Gene Name NDUFB5
Protein Type Enzyme
Biological Properties
General Function Involved in NADH dehydrogenase (ubiquinone) activity
Specific Function Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location
  1. Single-pass membrane protein
  2. Mitochondrion inner membrane
  3. Matrix side
Gene Properties
Chromosome Location Chromosome:3
Locus 3q26.33
SNPs NDUFB5
Gene Sequence
>570 bp
ATGGCGGCCATGAGTTTGTTGCGGCGGGTTTCGGTTACTGCGGTGGCAGCTCTGTCTGGC
CGGCCCCTTGGCACTCGCCTCGGATTTGGGGGCTTCCTCACTCGTGGCTTTCCGAAGGCT
GCTGCTCCTGTTCGACACAGTGGAGACCATGGGAAAAGACTATTTGTCATCAGACCTTCT
AGATTCTATGACAGGCGTTTTTTGAAGTTATTGAGATTCTACATTGCATTGACTGGGATT
CCAGTAGCAATTTTCATAACTCTGGTGAATGTATTCATTGGTCAAGCTGAACTAGCAGAA
ATTCCAGAAGGCTATGTCCCAGAACACTGGGAATATTATAAGCATCCCATATCAAGATGG
ATTGCCCGTAATTTCTATGATAGTCCTGAAAAGATATATGAAAGAACAATGGCCGTCCTT
CAGATTGAAGCTGAAAAGGCTGAATTACGGGTAAAGGAGCTGGAAGTGCGAAAATTGATG
CATGTGAGAGGAGATGGACCCTGGTATTACTATGAGACAATTGACAAGGAACTTATTGAT
CATTCTCCGAAAGCAACTCCTGACAATTAA
Protein Properties
Number of Residues 189
Molecular Weight 21750.0
Theoretical pI 10.02
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 73-93
Protein Sequence
>NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial
MAAMSLLRRVSVTAVAALSGRPLGTRLGFGGFLTRGFPKAAAPVRHSGDHGKRLFVIRPS
RFYDRRFLKLLRFYIALTGIPVAIFITLVNVFIGQAELAEIPEGYVPEHWEYYKHPISRW
IARNFYDSPEKIYERTMAVLQIEAEKAELRVKELEVRKLMHVRGDGPWYYYETIDKELID
HSPKATPDN
GenBank ID Protein 2909854
UniProtKB/Swiss-Prot ID O43674
UniProtKB/Swiss-Prot Entry Name NDUB5_HUMAN
PDB IDs Not Available
GenBank Gene ID AF047181
GeneCard ID NDUFB5
GenAtlas ID NDUFB5
HGNC ID HGNC:7700
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Murray J, Zhang B, Taylor SW, Oglesbee D, Fahy E, Marusich MF, Ghosh SS, Capaldi RA: The subunit composition of the human NADH dehydrogenase obtained by rapid one-step immunopurification. J Biol Chem. 2003 Apr 18;278(16):13619-22. Epub 2003 Feb 28. [PubMed:12611891 ]
  3. Ton C, Hwang DM, Dempsey AA, Liew CC: Identification and primary structure of five human NADH-ubiquinone oxidoreductase subunits. Biochem Biophys Res Commun. 1997 Dec 18;241(2):589-94. [PubMed:9425316 ]