You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP00253
Secondary Accession Numbers
  • 5485
Name Dopamine beta-hydroxylase
Synonyms
  1. Dopamine beta-monooxygenase
  2. Soluble dopamine beta-hydroxylase
Gene Name DBH
Protein Type Unknown
Biological Properties
General Function Involved in monooxygenase activity
Specific Function Conversion of dopamine to noradrenaline.
Pathways
  • (R)-noradrenaline biosynthesis
  • Alkaptonuria
  • Aromatic L-Aminoacid Decarboxylase Deficiency
  • Catecholamine Biosynthesis
  • Disulfiram Action Pathway
  • Dopamine beta-hydroxylase deficiency
  • Hawkinsinuria
  • Monoamine oxidase-a deficiency (MAO-A)
  • Tyrosine hydroxylase deficiency
  • Tyrosine Metabolism
  • Tyrosine metabolism
  • Tyrosinemia Type I
  • Tyrosinemia, transient, of the newborn
Reactions
Dopamine + Ascorbic acid + Oxygen → xi-Norepinephrine + Dehydroascorbic acid + Water details
Dopamine + Ascorbic acid + Oxygen → Norepinephrine + Dehydroascorbic acid + Water details
GO Classification
Biological Process
locomotory behavior
response to pain
regulation of cell proliferation
cellular nitrogen compound metabolic process
positive regulation of vasoconstriction
response to iron ion
leukocyte migration
multicellular organismal aging
behavioral response to ethanol
cellular response to manganese ion
cellular response to nicotine
cytokine production
fear response
homoiothermy
leukocyte mediated immunity
maternal behavior
octopamine metabolic process
response to amphetamine
sensory perception of taste
social behavior
visual learning
memory
glucose homeostasis
response to peptide hormone stimulus
response to ozone
regulation of apoptotic process
bone development
blood vessel remodeling
dopamine catabolic process
norepinephrine biosynthetic process
response to estradiol stimulus
response to copper ion
synaptic transmission
catecholamine biosynthetic process
Cellular Component
apical part of cell
dendrite
terminal button
chromaffin granule
chromaffin granule lumen
chromaffin granule membrane
varicosity
extracellular region
neuronal cell body
transport vesicle membrane
membrane
integral to membrane
Function
ion binding
cation binding
metal ion binding
binding
catalytic activity
transition metal ion binding
monooxygenase activity
oxidoreductase activity
oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced ascorbate as one donor, and incorporation of one atom of oxygen
copper ion binding
dopamine beta-monooxygenase activity
Molecular Function
dopamine beta-monooxygenase activity
L-ascorbic acid binding
copper ion binding
Process
metabolic process
cellular process
cellular metabolic process
oxidation reduction
cellular amino acid derivative metabolic process
cellular biogenic amine metabolic process
cellular amino acid and derivative metabolic process
cellular amino acid metabolic process
catecholamine metabolic process
histidine family amino acid metabolic process
histidine metabolic process
histidine catabolic process
Cellular Location
  1. Cytoplasmic vesicle
  2. Cytoplasmic vesicle
  3. Single-pass type II membrane protein
  4. secretory vesicle membrane
  5. secretory vesicle
  6. chromaffin granule membrane
  7. Single- pass type II membrane protein (Potential)
Gene Properties
Chromosome Location 9
Locus 9q34
SNPs DBH
Gene Sequence
>1854 bp
ATGCCCGCCCTCAGTCGCTGGGCCAGCCTGCCCGGCCCCAGCATGCGGGAGGCAGCCTTC
ATGTACAGCACAGCAGTGGCCATCTTCCTGGTCATCCTGGTGGCCGCACTGCAGGGCTCG
GCTCCCCGTGAGAGCCCCCTCCCCTATCACATCCCCCTGGACCCGGAGGGGTCCCTGGAG
CTCTCATGGAATGTCAGCTACACCCAGGAGGCCATCCATTTCCAGCTCCTGGTGCGGAGG
CTCAAGGCTGGCGTCCTGTTTGGGATGTCCGACCGTGGCGAGCTTGAGAACGCAGATCTC
GTGGTGCTCTGGACCGATGGGGACACTGCCTATTTTGCGGACGCCTGGAGTGACCAGAAG
GGGCAGATCCACCTGGATCCCCAGCAGGACTACCAGCTGCTGCAGGTGCAGAGGACCCCA
GAAGGCCTGACCCTGCTTTTCAAGAGGCCCTTTGGCACCTGCGACCCCAAGGATTACCTC
ATTGAAGACGGCACTGTCCACTTGGTCTACGGGATCCTGGAGGAGCCGTTCCGGTCACTG
GAGGCCATCAACGGCTCGGGCCTGCAGATGGGGCTGCAGAGGGTGCAGCTCCTGAAGCCC
AATATCCCCGAACCGGAGTTGCCCTCAGACGCGTGCACCATGGAGGTCCAAGCTCCCAAT
ATCCAGATCCCCAGCCAGGAGACCACGTACTGGTGCTACATTAAGGAGCTTCCAAAGGGC
TTCTCTCGGCACCACATTATCAAGTACGAGCCCATCGTCACCAAGGGCAATGAGGCCCTT
GTCCACCACATGGAAGTCTTCCAGTGCGCCCCCGAGATGGACAGCGTCCCCCACTTCAGC
GGGCCCTGCGACTCCAAGATGAAACCCGACCGCCTCAACTACTGCCGCCACGTGCTGGCC
GCCTGGGCCCTGGGTGCCAAGGCATTTTACTACCCAGAGGAAGCCGGCCTTGCCTTCGGG
GGTCCAGGGTCCTCCAGATATCTCCGCCTGGAAGTTCACTACCACAACCCACTGGTGATA
GAAGGACGAAACGACTCCTCAGGCATCCGCTTGTACTACACAGCCAAGCTGCGGCGCTTC
AACGCGGGGATCATGGAGCTGGGACTGGTGTACACGCCAGTGATGGCCATTCCACCACGG
GAGACCGCCTTCATCCTCACTGGCTACTGCACGGACAAGTGCACCCAGCTGGCACTGCCT
CCCTCCGGGATCCACATCTTCGCCTCTCAGCTCCACACACACCTGACTGGGAGAAAGGTG
GTCACAGTGCTGGTCCGGGACGGCCGGGAGTGGGAGATCGTGAACCAGGACAATCACTAC
AGCCCTCACTTCCAGGAGATCCGCATGTTGAAGAAGGTCGTGTCGGTCCATCCGGGAGAT
GTGCTCATCACCTCCTGCACGTACAACACAGAAGACCGGGAGCTGGCCACAGTGGGGGGC
TTCGGGATCCTGGAGGAGATGTGTGTCAACTACGTGCACTACTACCCCCAGACGCAGCTG
GAGCTCTGCAAGAGCGCTGTGGACGCCGGCTTCCTGCAGAAGTACTTCCACCTCATCAAC
AGGTTCAACAACGAGGATGTCTGCACCTGCCCTCAGGCGTCCGTGTCTCAGCAGTTCACC
TCTGTTCCCTGGAACTCCTTCAACCGCGACGTACTGAAGGCCCTGTACAGCTTCGCGCCC
ATCTCCATGCACTGCAACAAGTCCTCAGCCGTCCGCTTCCAGGGTGAATGGAACCTGCAG
CCCCTGCCCAAGGTCATCTCCACACTGGAAGAGCCCACCCCACAGTGCCCCACCAGCCAG
GGCCGAAGCCCTGCTGGCCCCACCGTTGTCAGCATTGGTGGGGGCAAAGGCTGA
Protein Properties
Number of Residues 617
Molecular Weight 69064.45
Theoretical pI 6.413
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Dopamine beta-hydroxylase
MPALSRWASLPGPSMREAAFMYSTAVAIFLVILVAALQGSAPRESPLPYHIPLDPEGSLE
LSWNVSYTQEAIHFQLLVRRLKAGVLFGMSDRGELENADLVVLWTDGDTAYFADAWSDQK
GQIHLDPQQDYQLLQVQRTPEGLTLLFKRPFGTCDPKDYLIEDGTVHLVYGILEEPFRSL
EAINGSGLQMGLQRVQLLKPNIPEPELPSDACTMEVQAPNIQIPSQETTYWCYIKELPKG
FSRHHIIKYEPIVTKGNEALVHHMEVFQCAPEMDSVPHFSGPCDSKMKPDRLNYCRHVLA
AWALGAKAFYYPEEAGLAFGGPGSSRYLRLEVHYHNPLVIEGRNDSSGIRLYYTAKLRRF
NAGIMELGLVYTPVMAIPPRETAFILTGYCTDKCTQLALPPSGIHIFASQLHTHLTGRKV
VTVLVRDGREWEIVNQDNHYSPHFQEIRMLKKVVSVHPGDVLITSCTYNTEDRELATVGG
FGILEEMCVNYVHYYPQTQLELCKSAVDAGFLQKYFHLINRFNNEDVCTCPQASVSQQFT
SVPWNSFNRDVLKALYSFAPISMHCNKSSAVRFQGEWNLQPLPKVISTLEEPTPQCPTSQ
GRSPAGPTVVSIGGGKG
GenBank ID Protein 123230459
UniProtKB/Swiss-Prot ID P09172
UniProtKB/Swiss-Prot Entry Name DOPO_HUMAN
PDB IDs Not Available
GenBank Gene ID AL365494
GeneCard ID DBH
GenAtlas ID DBH
HGNC ID HGNC:2689
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Humphray SJ, Oliver K, Hunt AR, Plumb RW, Loveland JE, Howe KL, Andrews TD, Searle S, Hunt SE, Scott CE, Jones MC, Ainscough R, Almeida JP, Ambrose KD, Ashwell RI, Babbage AK, Babbage S, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beasley H, Beasley O, Bird CP, Bray-Allen S, Brown AJ, Brown JY, Burford D, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Chen Y, Clarke G, Clark SY, Clee CM, Clegg S, Collier RE, Corby N, Crosier M, Cummings AT, Davies J, Dhami P, Dunn M, Dutta I, Dyer LW, Earthrowl ME, Faulkner L, Fleming CJ, Frankish A, Frankland JA, French L, Fricker DG, Garner P, Garnett J, Ghori J, Gilbert JG, Glison C, Grafham DV, Gribble S, Griffiths C, Griffiths-Jones S, Grocock R, Guy J, Hall RE, Hammond S, Harley JL, Harrison ES, Hart EA, Heath PD, Henderson CD, Hopkins BL, Howard PJ, Howden PJ, Huckle E, Johnson C, Johnson D, Joy AA, Kay M, Keenan S, Kershaw JK, Kimberley AM, King A, Knights A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd C, Lloyd DM, Lovell J, Martin S, Mashreghi-Mohammadi M, Matthews L, McLaren S, McLay KE, McMurray A, Milne S, Nickerson T, Nisbett J, Nordsiek G, Pearce AV, Peck AI, Porter KM, Pandian R, Pelan S, Phillimore B, Povey S, Ramsey Y, Rand V, Scharfe M, Sehra HK, Shownkeen R, Sims SK, Skuce CD, Smith M, Steward CA, Swarbreck D, Sycamore N, Tester J, Thorpe A, Tracey A, Tromans A, Thomas DW, Wall M, Wallis JM, West AP, Whitehead SL, Willey DL, Williams SA, Wilming L, Wray PW, Young L, Ashurst JL, Coulson A, Blocker H, Durbin R, Sulston JE, Hubbard T, Jackson MJ, Bentley DR, Beck S, Rogers J, Dunham I: DNA sequence and analysis of human chromosome 9. Nature. 2004 May 27;429(6990):369-74. [PubMed:15164053 ]
  3. Liu T, Qian WJ, Gritsenko MA, Camp DG 2nd, Monroe ME, Moore RJ, Smith RD: Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry. J Proteome Res. 2005 Nov-Dec;4(6):2070-80. [PubMed:16335952 ]
  4. Cargill M, Altshuler D, Ireland J, Sklar P, Ardlie K, Patil N, Shaw N, Lane CR, Lim EP, Kalyanaraman N, Nemesh J, Ziaugra L, Friedland L, Rolfe A, Warrington J, Lipshutz R, Daley GQ, Lander ES: Characterization of single-nucleotide polymorphisms in coding regions of human genes. Nat Genet. 1999 Jul;22(3):231-8. [PubMed:10391209 ]
  5. Lamouroux A, Vigny A, Faucon Biguet N, Darmon MC, Franck R, Henry JP, Mallet J: The primary structure of human dopamine-beta-hydroxylase: insights into the relationship between the soluble and the membrane-bound forms of the enzyme. EMBO J. 1987 Dec 20;6(13):3931-7. [PubMed:3443096 ]
  6. Kobayashi K, Kurosawa Y, Fujita K, Nagatsu T: Human dopamine beta-hydroxylase gene: two mRNA types having different 3'-terminal regions are produced through alternative polyadenylation. Nucleic Acids Res. 1989 Feb 11;17(3):1089-102. [PubMed:2922261 ]
  7. Li B, Tsing S, Kosaka AH, Nguyen B, Osen EG, Bach C, Chan H, Barnett J: Expression of human dopamine beta-hydroxylase in Drosophila Schneider 2 cells. Biochem J. 1996 Jan 1;313 ( Pt 1):57-64. [PubMed:8546710 ]
  8. Williams HJ, Bray N, Murphy KC, Cardno AG, Jones LA, Owen MJ: No evidence for allelic association between schizophrenia and a functional variant of the human dopamine beta-hydroxylase gene (DBH). Am J Med Genet. 1999 Oct 15;88(5):557-9. [PubMed:10490716 ]
  9. Halushka MK, Fan JB, Bentley K, Hsie L, Shen N, Weder A, Cooper R, Lipshutz R, Chakravarti A: Patterns of single-nucleotide polymorphisms in candidate genes for blood-pressure homeostasis. Nat Genet. 1999 Jul;22(3):239-47. [PubMed:10391210 ]
  10. Kim CH, Zabetian CP, Cubells JF, Cho S, Biaggioni I, Cohen BM, Robertson D, Kim KS: Mutations in the dopamine beta-hydroxylase gene are associated with human norepinephrine deficiency. Am J Med Genet. 2002 Mar 1;108(2):140-7. [PubMed:11857564 ]