You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP00255
Secondary Accession Numbers
  • 5487
Name L-fucose kinase
Synonyms
  1. Fucokinase
Gene Name FUK
Protein Type Enzyme
Biological Properties
General Function Involved in ATP binding
Specific Function Takes part in the salvage pathway for reutilization of fucose from the degradation of oligosaccharides.
Pathways
  • Amino sugar and nucleotide sugar metabolism
  • Fructose and Mannose Degradation
  • Fructose and mannose metabolism
  • Fructose intolerance, hereditary
  • Fructosuria
Reactions
Adenosine triphosphate + L-Fucose → ADP + Fucose 1-phosphate details
GO Classification
Cellular Component
cytoplasm
Component
cell part
intracellular part
cytoplasm
Function
binding
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
phosphotransferase activity, alcohol group as acceptor
Molecular Function
fucokinase activity
ATP binding
Process
phosphorus metabolic process
phosphate metabolic process
metabolic process
cellular metabolic process
phosphorylation
Cellular Location Not Available
Gene Properties
Chromosome Location 16
Locus 16q22.1
SNPs FUK
Gene Sequence
>3255 bp
ATGGAGCAGCCGAAGGGAGTTGATTGGACAGTCATCATCCTGACCTGCCAGTACAAGGAC
AGTGTCCAGGTCTTTCAGAGAGAACTGGAAGTGCGGCAGAAGCGGGAGCAGATCCCTGCT
GGGACGCTGTTACTGGCCGTGGAGGACCCAGAGAAGCGTGTGGGCAGCGGAGGAGCCACC
CTCAACGCCCTGCTGGTGGCTGCTGAACACCTGAGTGCCCGGGCAGGCTTCACTGTGGTC
ACATCCGATGTCCTGCACTCGGCCTGGATCCTCATTCTGCACATGGGTCGAGACTTCCCC
TTTGATGACTGTGGCAGGGCTTTCACCTGCCTCCCCGTGGAGAACCCCGAGGCCCCCGTG
GAAGCCTTGGTCTGCAACCTGGACTGCCTGCTGGACATCATGACCTATCGGCTGGGCCCG
GGCTCCCCGCCAGGCGTGTGGGTCTGCAGCACCGACATGCTGCTGTCTGTTCCTGCAAAT
CCTGGTATCAGCTGGGACAGCTTCCGGGGAGCCAGAGTGATCGCCCTCCCAGGGAGCCCG
GCCTACGCTCAGAATCATGGCGTCTACCTAACTGACCCCCAGGGCCTTGTTTTGGACATT
TACTACCAGGGCACTGAGGCAGAGATTCAGCGGTGTGTCAGGCCTGATGGGCGGGTGCCA
CTGGTCTCTGGGGTTGTCTTCTTCTCTGTGGAGACTGCCGAGCGCCTCCTAGCCACCCAC
GTGAGCCCGCCCCTGGATGCCTGCACCTACCTAGGCTTGGACTCCGGAGCCCGGCCTGTC
CAGCTGTCTCTGTTTTTTGACATTCTCCACTGCATGGCTGAGAACGTGACCAGGGAGGAC
TTCCTGGTGGGGAGGCCCCCAGAGTTGGGGCAAGGCGATGCAGATGTAGCGGGTTATCTG
CAGAGCGCCCGGGCCCAGCTGTGGAGGGAGCTTCGCGATCAGCCCCTTACCATGGCCTAT
GTCTCCAGCGGCAGCTACAGCTACATGACCTCCTCAGCCAGTGAGTTCCTGCTCAGCCTC
ACACTCCCCGGGGCTCCTGGGGCCCAGATTGTGCACTCCCAGGTGGAGGAGCAGCAGCTT
CTGGCGGCCGGGAGCTCTGTGGTCAGCTGCCTGCTGGAGGGCCCTGTCCAGCTGGGTCCT
GGGAGCGTCCTGCAGCACTGCCACCTGCAGGGCCCCATTCACATAGGCGCTGGCTGCTTG
GTGACTGGCCTGGATACAGCCCACTCCAAGGCCCTGCATGGCCGGGAGCTGCGTGACCTT
GTCCTGCAGGGACACCACACGCGGCTACACGGCTCCCCGGGCCACGCCTTCACCCTCGTT
GGCCGTCTGGACAGCTGGGAGAGACAGGGGGCAGGCACATATCTCAACGTGCCCTGGAGT
GAATTCTTCAAGAGGACAGGTGTTCGAGCCTGGGACCTGTGGGACCCTGAGACGCTGCCC
GCAGAGTACTGCCTTCCCAGCGCCCGCCTCTTTCCTGTGCTCCACCCCTCGAGGGAGCTG
GGACCCCAGGACCTGCTGTGGATGCTGGACCACCAGGAGGATGGGGGCGAGGCCCTGCGA
GCCTGGCGGGCCTCCTGGCGCCTGTCCTGGGAGCAGCTGCAGCCGTGCCTGGATCGGGCT
GCCACGCTGGCCTCTCGCCGGGACCTGTTCTTCCGCCAGGCCCTGCATAAGGCGCGGCAC
GTGCTGGAGGCCCGGCAGGACCTCAGCCTGCGCCCGCTGATCTGGGCTGCTGTCCGCGAG
GGCTGCCCCGGGCCCCTGCTGGCCACGCTGGACCAGGTTGCAGCTGGGGCAGGAGACCCT
GGTGTGGCGGCACGGGCACTGGCCTGTGTGGCGGACGTCCTGGGCTGCATGGCAGAGGGC
CGTGGGGGCTTGCGGAGCGGGCCAGCTGCCAACCCTGAGTGGATGCGGCCCTTCTCATAC
CTGGAGTGTGGAGACCTGGCAGCGGGCGTGGAGGCGCTTGCCCAGGAGAGGGACAAGTGG
CTAAGCAGGCCAGCCTTGCTGGTGCGAGCGGCCCGCCACTATGAGGGGGCTGGTCAGATC
CTGATCCGCCAGGCTGTGATGTCAGCCCAGCACTTTGTCTCCACAGAGCAGGTGGAACTG
CCGGGACCTGGGCAGTGGGTGGTGGCTGAGTGCCCGGCCCGTGTGGATTTCTCTGGGGGC
TGGAGTGACACGCCACCCCTTGCCTATGAGCTTGGCGGGGCTGTGCTGGGCCTGGCTGTG
CGAGTGGACGGCCGCCGGCCCATCGGAGCCAGGGCACGCCGCATCCCGGAGCCTGAGCTG
TGGCTGGCGGTGGGGCCTCGGCAGGATGAGATGACTGTGAAGATAGTGTGCCGGTGCCTG
GCTGACCTGCGGGACTACTGCCAGCCTCATGCCCCAGGGGCCCTGCTGAAGGCGGCCTTC
ATCTGTGCAGGGATCGTGCATGTCCACTCGGAACTCCAGCTGAGTGAGCAGCTGCTCCGC
ACCTTCGGGGGCGGCTTTGAGCTGCACACCTGGTCTGAGCTGCCCCACGGCTCTGGCCTG
GGCACCAGCAGCATCCTGGCAGGCACTGCCCTGGCTGCCTTGCAGCGAGCCGCAGGCCGG
GTGGTGGGCACGGAAGCCCTGATCCACGCAGTGCTGCACCTGGAGCAGGTGCTCACCACT
GGAGGTGGCTGGCAGGACCAAGTAGGTGGCCTAATGCCTGGCATCAAGGTGGGGCGCTCC
CGGGCTCAGCTGCCACTGAAGGTGGAGGTAGAAGAGGTCACGGTGCCTGAGGGCTTTGTC
CAGAAGCTCAATGACCACCTGCTCTTGGTGTACACTGGCAAGACCCGCCTGGCTCGGAAC
CTGCTGCAGGATGTGCTGAGGAGCTGGTATGCCCGACTTCCTGCTGTGGTGCAGAATGCC
CACAGCCTGGTACGGCAAACTGAGGAGTGTGCTGAAGGCTTCCGCCAAGGAAGCCTGCCT
CTGCTGGGCCAGTGCCTGACCTCGTACTGGGAGCAGAAGAAGCTCATGGCTCCAGGCTGT
GAGCCCCTGACTGTGCGGCGTATGATGGATGTCCTGGCCCCCCACGTGCATGGCCAGAGC
CTGGCTGGGGCAGGCGGTGGAGGCTTTCTCTATCTGTTGACCAAGGAGCCACAGCAAAAG
GAGGCCTTGGAGGCGGTGCTGGCCAAGACCGAGGGCCTTGGGAATTACAGCATCCACCTG
GTTGAAGTGGACACTCAGGGCCTGAGCCTGAAGCTGCTGGGGACCGAGGCCTCAACCTGT
TGCCCTTTCCCATGA
Protein Properties
Number of Residues 1084
Molecular Weight 117621.795
Theoretical pI 6.258
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>L-fucose kinase
MEQPKGVDWTVIILTCQYKDSVQVFQRELEVRQKREQIPAGTLLLAVEDPEKRVGSGGAT
LNALLVAAEHLSARAGFTVVTSDVLHSAWILILHMGRDFPFDDCGRAFTCLPVENPEAPV
EALVCNLDCLLDIMTYRLGPGSPPGVWVCSTDMLLSVPANPGISWDSFRGARVIALPGSP
AYAQNHGVYLTDPQGLVLDIYYQGTEAEIQRCVRPDGRVPLVSGVVFFSVETAERLLATH
VSPPLDACTYLGLDSGARPVQLSLFFDILHCMAENVTREDFLVGRPPELGQGDADVAGYL
QSARAQLWRELRDQPLTMAYVSSGSYSYMTSSASEFLLSLTLPGAPGAQIVHSQVEEQQL
LAAGSSVVSCLLEGPVQLGPGSVLQHCHLQGPIHIGAGCLVTGLDTAHSKALHGRELRDL
VLQGHHTRLHGSPGHAFTLVGRLDSWERQGAGTYLNVPWSEFFKRTGVRAWDLWDPETLP
AEYCLPSARLFPVLHPSRELGPQDLLWMLDHQEDGGEALRAWRASWRLSWEQLQPCLDRA
ATLASRRDLFFRQALHKARHVLEARQDLSLRPLIWAAVREGCPGPLLATLDQVAAGAGDP
GVAARALACVADVLGCMAEGRGGLRSGPAANPEWMRPFSYLECGDLAAGVEALAQERDKW
LSRPALLVRAARHYEGAGQILIRQAVMSAQHFVSTEQVELPGPGQWVVAECPARVDFSGG
WSDTPPLAYELGGAVLGLAVRVDGRRPIGARARRIPEPELWLAVGPRQDEMTVKIVCRCL
ADLRDYCQPHAPGALLKAAFICAGIVHVHSELQLSEQLLRTFGGGFELHTWSELPHGSGL
GTSSILAGTALAALQRAAGRVVGTEALIHAVLHLEQVLTTGGGWQDQVGGLMPGIKVGRS
RAQLPLKVEVEEVTVPEGFVQKLNDHLLLVYTGKTRLARNLLQDVLRSWYARLPAVVQNA
HSLVRQTEECAEGFRQGSLPLLGQCLTSYWEQKKLMAPGCEPLTVRRMMDVLAPHVHGQS
LAGAGGGGFLYLLTKEPQQKEALEAVLAKTEGLGNYSIHLVEVDTQGLSLKLLGTEASTC
CPFP
GenBank ID Protein 63175654
UniProtKB/Swiss-Prot ID Q8N0W3
UniProtKB/Swiss-Prot Entry Name FUK_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_145059.2
GeneCard ID FUK
GenAtlas ID FUK
HGNC ID HGNC:29500
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Hinderlich S, Berger M, Blume A, Chen H, Ghaderi D, Bauer C: Identification of human L-fucose kinase amino acid sequence. Biochem Biophys Res Commun. 2002 Jun 14;294(3):650-4. [PubMed:12056818 ]