You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP00288
Secondary Accession Numbers
  • 5520
Name Carbohydrate sulfotransferase 13
Synonyms
  1. C4ST-3
  2. C4ST3
  3. Chondroitin 4-O-sulfotransferase 3
  4. Chondroitin 4-sulfotransferase 3
Gene Name CHST13
Protein Type Enzyme
Biological Properties
General Function Involved in sulfotransferase activity
Specific Function Catalyzes the transfer of sulfate to position 4 of the N-acetylgalactosamine (GalNAc) residue of chondroitin. Chondroitin sulfate constitutes the predominant proteoglycan present in cartilage and is distributed on the surfaces of many cells and extracellular matrices. Transfers sulfate to the C4 hydroxyl of beta1,4-linked GalNAc that is substituted with a beta-linked glucuronic acid at the C-3 hydroxyl. No activity toward dermatan.
Pathways
  • Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate
  • sulfur metabolism
Reactions
Phosphoadenosine phosphosulfate + Chondroitin → Adenosine 3',5'-diphosphate + chondroitin 4'-sulfate details
Phosphoadenosine phosphosulfate + Chondroitin → Adenosine 3',5'-diphosphate + Chondroitin 4-sulfate details
GO Classification
Biological Process
chondroitin sulfate biosynthetic process
carbohydrate biosynthetic process
carbohydrate metabolic process
Cellular Component
integral to membrane
Golgi membrane
Component
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
catalytic activity
transferase activity
transferase activity, transferring sulfur-containing groups
sulfotransferase activity
Molecular Function
chondroitin 4-sulfotransferase activity
N-acetylgalactosamine 4-O-sulfotransferase activity
Process
metabolic process
primary metabolic process
carbohydrate metabolic process
carbohydrate biosynthetic process
Cellular Location
  1. Golgi apparatus membrane
  2. Single-pass type II membrane protein
Gene Properties
Chromosome Location 3
Locus 3q21.3
SNPs CHST13
Gene Sequence
>1026 bp
ATGGGGAGGCGCTGCTGCCGGCGGCGCGTGCTGGCGGCCGCCTGTCTGGGCGCCGCGCTC
CTGCTCCTATGCGCCGCGCCCCGCTCCCTGCGCCCGGCATTTGGAAACAGAGCCCTGGGC
TCCAGCTGGCTTGGTGGGGAGAAGAGAAGCCCCCTGCAGAAGCTCTATGACCTGGATCAG
GACCCGCGCTCGACCCTGGCGAAGGTGCACCGTCAGCGGCGCGACCTGCTGAACAGCGCC
TGTAGCCGCCACTCACGCCGGCAGCGCCTGCTACAGCCGGAGGACCTGCGGCACGTGCTG
GTGGACGACGCGCATGGCCTGCTCTACTGCTACGTGCCCAAGGTGGCCTGCACCAACTGG
AAGCGCGTGCTGCTGGCGCTGAGCGGCCAAGCCCGCGGCGACCCGCGCGCCATCTCCGCG
CAAGAGGCGCACGCGCCTGGCCGCCTGCCCTCACTGGCCGACTTCAGCCCCGCCGAGATC
AACCGGCGCCTGCGCGCCTACTTGGCCTTCCTGTTCGTGCGGGAGCCCTTCGAGCGCCTG
GCATCGGCTTACCGCAACAAGCTCGCGCGCCCCTACAGCGCCGCCTTCCAGAGGCGCTAC
GGTGCACGCATCGTTCAGCGCCTGCGGCCGCGCGCGCTCCCCGACGCCCGGGCCCGCGGC
CACGACGTGCGCTTCGCGGAGTTCCTGGCCTACCTGCTGGACCCGCGCACGCGGCGTGAG
GAGCCCTTCAACGAGCACTGGGAGCGCGCGCACGCGCTCTGCCACCCGTGTCGCCTCCGC
TACGACGTCGTGGGCAAGTTCGAGACGCTGGCGGAGGACGCGGCCTTCGTGCTGGGCCTG
GCGGGCGCATCCGACCTGAGCTTCCCTGGGCCGCCGCGGCCCCGGGGAGCCGCCGCCTCC
CGCGACCTGGCAGCGCGCCTCTTCCGGGACATCAGCCCCTTCTACCAGCGGCGCCTCTTC
GACCTCTACAAGATGGACTTCCTGCTTTTCAACTACTCCGCCCCCTCCTACCTGCGGCTG
CTCTAG
Protein Properties
Number of Residues 341
Molecular Weight 38919.34
Theoretical pI 10.543
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Carbohydrate sulfotransferase 13
MGRRCCRRRVLAAACLGAALLLLCAAPRSLRPAFGNRALGSSWLGGEKRSPLQKLYDLDQ
DPRSTLAKVHRQRRDLLNSACSRHSRRQRLLQPEDLRHVLVDDAHGLLYCYVPKVACTNW
KRVLLALSGQARGDPRAISAQEAHAPGRLPSLADFSPAEINRRLRAYLAFLFVREPFERL
ASAYRNKLARPYSAAFQRRYGARIVQRLRPRALPDARARGHDVRFAEFLAYLLDPRTRRE
EPFNEHWERAHALCHPCRLRYDVVGKFETLAEDAAFVLGLAGASDLSFPGPPRPRGAAAS
RDLAARLFRDISPFYQRRLFDLYKMDFLLFNYSAPSYLRLL
GenBank ID Protein 22651777
UniProtKB/Swiss-Prot ID Q8NET6
UniProtKB/Swiss-Prot Entry Name CHSTD_HUMAN
PDB IDs Not Available
GenBank Gene ID AY120869
GeneCard ID CHST13
GenAtlas ID CHST13
HGNC ID HGNC:21755
References
General References
  1. Kang HG, Evers MR, Xia G, Baenziger JU, Schachner M: Molecular cloning and characterization of chondroitin-4-O-sulfotransferase-3. A novel member of the HNK-1 family of sulfotransferases. J Biol Chem. 2002 Sep 20;277(38):34766-72. Epub 2002 Jun 21. [PubMed:12080076 ]