You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP00319
Secondary Accession Numbers
  • 5555
Name Sialidase-3
Synonyms
  1. Ganglioside sialidase
  2. Membrane sialidase
  3. N-acetyl-alpha-neuraminidase 3
Gene Name NEU3
Protein Type Enzyme
Biological Properties
General Function Involved in exo-alpha-sialidase activity
Specific Function Plays a role in modulating the ganglioside content of the lipid bilayer at the level of membrane-bound sialyl glycoconjugates
Pathways
  • Fabry disease
  • Gaucher Disease
  • Globoid Cell Leukodystrophy
  • Krabbe disease
  • Metachromatic Leukodystrophy (MLD)
  • Sphingolipid Metabolism
Reactions Not Available
GO Classification Not Available
Cellular Location
  1. Peripheral membrane protein
  2. Membrane
Gene Properties
Chromosome Location Chromosome:1
Locus 11q13.5
SNPs NEU3
Gene Sequence
>1287 bp
ATGGAAGAAGTGACAACATGCTCCTTCAACAGCCCTCTGTTCCGGCAGGAAGATGACAGA
GGGATTACCTACCGGATCCCAGCCCTGCTCTACATACCCCCCACCCACACCTTCCTGGCC
TTTGCAGAGAAGCGTTCCACGAGGAGAGATGAGGATGCTCTCCACCTGGTGCTGAGGCGA
GGGTTGAGGATTGGGCAGTTGGTACAGTGGGGGCCCCTGAAGCCACTGATGGAAGCCACA
CTACCGGGGCATCGGACCATGAACCCCTGTCCTGTATGGGAGCAGAAGAGTGGTTGTGTG
TTCCTGTTCTTCATCTGTGTGCGGGGCCATGTCACAGAGCGTCAACAGATTGTGTCAGGC
AGGAATGCTGCCCGCCTTTGCTTCATCTACAGTCAGGATGCTGGATGTTCATGGAGTGAG
GTGAGGGACTTGACTGAGGAGGTCATTGGCTCAGAGCTGAAGCACTGGGCCACATTTGCT
GTGGGCCCAGGTCATGGCATCCAGCTGCAGTCAGGGAGACTGGTCATCCCTGCGTATACC
TACTACATCCCTTCCTGGTTCTTTTGCTTCCAGCTACCATGTAAAACCAGGCCTCATTCT
CTGATGATCTACAGTGATGACCTAGGGGTCACATGGCACCATGGTAGACTCATTAGGCCC
ATGGTTACAGTAGAATGTGAAGTGGCAGAGGTGACTGGGAGGGCTGGCCACCCTGTGCTA
TATTGCAGTGCCCGGACACCAAACAGGTGCCGGGCAGAGGCGCTCAGCACTGACCATGGT
GAAGGCTTTCAGAGACTGGCCCTGAGTCGACAGCTCTGTGAGCCCCCACATGGTTGCCAA
GGGAGTGTGGTAAGTTTCCGGCCCCTGGAGATCCCACATAGGTGCCAGGACTCTAGCAGC
AAAGATGCACCCACCATTCAGCAGAGCTCTCCAGGCAGTTCACTGAGGCTGGAGGAGGAA
GCTGGAACACCGTCAGAATCATGGCTCTTGTACTCACACCCAACCAGTAGGAAACAGAGG
GTTGACCTAGGTATCTATCTCAACCAGACCCCCTTGGAGGCTGCCTGCTGGTCCCGCCCC
TGGATCTTGCACTGTGGGCCCTGTGGCTACTCTGATCTGGCTGCTCTGGAGGAGGAGGGC
TTGTTTGGGTGTTTGTTTGAATGTGGGACCAAGCAAGAGTGTGAGCAGATTGCCTTCCGC
CTGTTTACACACCGGGAGATCCTGAGTCACCTGCAGGGGGACTGCACCAGCCCTGGTAGG
AACCCAAGCCAATTCAAAAGCAATTAA
Protein Properties
Number of Residues 428
Molecular Weight 48251.5
Theoretical pI 7.17
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Sialidase-3
MEEVTTCSFNSPLFRQEDDRGITYRIPALLYIPPTHTFLAFAEKRSTRRDEDALHLVLRR
GLRIGQLVQWGPLKPLMEATLPGHRTMNPCPVWEQKSGCVFLFFICVRGHVTERQQIVSG
RNAARLCFIYSQDAGCSWSEVRDLTEEVIGSELKHWATFAVGPGHGIQLQSGRLVIPAYT
YYIPSWFFCFQLPCKTRPHSLMIYSDDLGVTWHHGRLIRPMVTVECEVAEVTGRAGHPVL
YCSARTPNRCRAEALSTDHGEGFQRLALSRQLCEPPHGCQGSVVSFRPLEIPHRCQDSSS
KDAPTIQQSSPGSSLRLEEEAGTPSESWLLYSHPTSRKQRVDLGIYLNQTPLEAACWSRP
WILHCGPCGYSDLAALEEEGLFGCLFECGTKQECEQIAFRLFTHREILSHLQGDCTSPGR
NPSQFKSN
GenBank ID Protein 5631293
UniProtKB/Swiss-Prot ID Q9UQ49
UniProtKB/Swiss-Prot Entry Name NEUR3_HUMAN
PDB IDs Not Available
GenBank Gene ID AB008185
GeneCard ID NEU3
GenAtlas ID NEU3
HGNC ID HGNC:7760
References
General References
  1. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. [PubMed:18691976 ]
  2. Wada T, Yoshikawa Y, Tokuyama S, Kuwabara M, Akita H, Miyagi T: Cloning, expression, and chromosomal mapping of a human ganglioside sialidase. Biochem Biophys Res Commun. 1999 Jul 22;261(1):21-7. [PubMed:10405317 ]
  3. Monti E, Bassi MT, Papini N, Riboni M, Manzoni M, Venerando B, Croci G, Preti A, Ballabio A, Tettamanti G, Borsani G: Identification and expression of NEU3, a novel human sialidase associated to the plasma membrane. Biochem J. 2000 Jul 1;349(Pt 1):343-51. [PubMed:10861246 ]