You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP00355
Secondary Accession Numbers
  • 5591
Name Sulfotransferase family cytosolic 2B member 1
Synonyms
  1. Alcohol sulfotransferase
  2. Hydroxysteroid sulfotransferase 2
  3. ST2B1
  4. Sulfotransferase 2B1
Gene Name SULT2B1
Protein Type Enzyme
Biological Properties
General Function Involved in sulfotransferase activity
Specific Function Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs and xenobiotic compounds. Sulfonation increases the water solubility of most compounds, and therefore their renal excretion, but it can also result in bioactivation to form active metabolites. Sulfates hydroxysteroids like DHEA. Isoform 1 preferentially sulfonates cholesterol, and isoform 2 avidly sulfonates pregnenolone but not cholesterol.
Pathways
  • 17-Beta Hydroxysteroid Dehydrogenase III Deficiency
  • Androgen and Estrogen Metabolism
  • Aromatase deficiency
  • Steroid hormone biosynthesis
  • Sulfate/Sulfite Metabolism
  • Sulfite oxidase deficiency
  • sulfur metabolism
Reactions
Phosphoadenosine phosphosulfate + an alcohol → Adenosine 3',5'-diphosphate + an alkyl sulfate details
Alcohol + Phosphoadenosine phosphosulfate → Alkyl sulfate + Adenosine 3',5'-diphosphate details
Phosphoadenosine phosphosulfate + Dehydroepiandrosterone → Adenosine 3',5'-diphosphate + Dehydroepiandrosterone sulfate details
Cholesterol + Phosphoadenosine phosphosulfate → Cholesterol sulfate + Adenosine 3',5'-diphosphate details
Pregnenolone + Phosphoadenosine phosphosulfate → 3beta-Hydroxypregn-5-en-20-one sulfate + Adenosine 3',5'-diphosphate details
3,4,5-trihydroxy-2-[hydroxy(3,4,5-trihydroxyoxan-2-yl)methyl]-6-[3-(4-hydroxyphenyl)propanoyl]-4-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]cyclohexa-2,5-dien-1-one → [(3,4,5-trihydroxy-6-{1,2,6-trihydroxy-3-[hydroxy(3,4,5-trihydroxyoxan-2-yl)methyl]-5-[3-(4-hydroxyphenyl)propanoyl]-4-oxocyclohexa-2,5-dien-1-yl}oxan-2-yl)methoxy]sulfonic acid details
3,4,5-trihydroxy-2-[hydroxy(3,4,5-trihydroxyoxan-2-yl)methyl]-6-[3-(4-hydroxyphenyl)propanoyl]-4-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]cyclohexa-2,5-dien-1-one → {4,5-dihydroxy-2-[hydroxy({2,3,4-trihydroxy-5-[3-(4-hydroxyphenyl)propanoyl]-6-oxo-3-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]cyclohexa-1,4-dien-1-yl})methyl]oxan-3-yl}oxidanesulfonic acid details
3,4,5-trihydroxy-2-[hydroxy(3,4,5-trihydroxyoxan-2-yl)methyl]-6-[3-(4-hydroxyphenyl)propanoyl]-4-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]cyclohexa-2,5-dien-1-one → {3,5-dihydroxy-2-[hydroxy({2,3,4-trihydroxy-5-[3-(4-hydroxyphenyl)propanoyl]-6-oxo-3-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]cyclohexa-1,4-dien-1-yl})methyl]oxan-4-yl}oxidanesulfonic acid details
3,4,5-trihydroxy-2-[hydroxy(3,4,5-trihydroxyoxan-2-yl)methyl]-6-[3-(4-hydroxyphenyl)propanoyl]-4-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]cyclohexa-2,5-dien-1-one → {4,5-dihydroxy-6-[hydroxy({2,3,4-trihydroxy-5-[3-(4-hydroxyphenyl)propanoyl]-6-oxo-3-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]cyclohexa-1,4-dien-1-yl})methyl]oxan-3-yl}oxidanesulfonic acid details
3,4,5-trihydroxy-2-[hydroxy(3,4,5-trihydroxyoxan-2-yl)methyl]-6-[3-(4-hydroxyphenyl)propanoyl]-4-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]cyclohexa-2,5-dien-1-one → ({2,3,4-trihydroxy-5-[3-(4-hydroxyphenyl)propanoyl]-6-oxo-3-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]cyclohexa-1,4-dien-1-yl}(3,4,5-trihydroxyoxan-2-yl)methoxy)sulfonic acid details
3,4,5-trihydroxy-2-[hydroxy(3,4,5-trihydroxyoxan-2-yl)methyl]-6-[3-(4-hydroxyphenyl)propanoyl]-4-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]cyclohexa-2,5-dien-1-one → [4,5-dihydroxy-2-(hydroxymethyl)-6-{1,2,6-trihydroxy-3-[hydroxy(3,4,5-trihydroxyoxan-2-yl)methyl]-5-[3-(4-hydroxyphenyl)propanoyl]-4-oxocyclohexa-2,5-dien-1-yl}oxan-3-yl]oxidanesulfonic acid details
3,4,5-trihydroxy-2-[hydroxy(3,4,5-trihydroxyoxan-2-yl)methyl]-6-[3-(4-hydroxyphenyl)propanoyl]-4-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]cyclohexa-2,5-dien-1-one → [3,5-dihydroxy-2-(hydroxymethyl)-6-{1,2,6-trihydroxy-3-[hydroxy(3,4,5-trihydroxyoxan-2-yl)methyl]-5-[3-(4-hydroxyphenyl)propanoyl]-4-oxocyclohexa-2,5-dien-1-yl}oxan-4-yl]oxidanesulfonic acid details
3,4,5-trihydroxy-2-[hydroxy(3,4,5-trihydroxyoxan-2-yl)methyl]-6-[3-(4-hydroxyphenyl)propanoyl]-4-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]cyclohexa-2,5-dien-1-one → [4,5-dihydroxy-6-(hydroxymethyl)-2-{1,2,6-trihydroxy-3-[hydroxy(3,4,5-trihydroxyoxan-2-yl)methyl]-5-[3-(4-hydroxyphenyl)propanoyl]-4-oxocyclohexa-2,5-dien-1-yl}oxan-3-yl]oxidanesulfonic acid details
3,4,5-trihydroxy-2-[hydroxy(3,4,5-trihydroxyoxan-2-yl)methyl]-6-[(2E)-3-(4-hydroxyphenyl)prop-2-enoyl]-4-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]cyclohex-2-en-1-one → [(3,4,5-trihydroxy-6-{1,2,6-trihydroxy-3-[hydroxy(3,4,5-trihydroxyoxan-2-yl)methyl]-5-[(2E)-3-(4-hydroxyphenyl)prop-2-enoyl]-4-oxocyclohex-2-en-1-yl}oxan-2-yl)methoxy]sulfonic acid details
3,4,5-trihydroxy-2-[hydroxy(3,4,5-trihydroxyoxan-2-yl)methyl]-6-[(2E)-3-(4-hydroxyphenyl)prop-2-enoyl]-4-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]cyclohex-2-en-1-one → {2,3-dihydroxy-4-[hydroxy(3,4,5-trihydroxyoxan-2-yl)methyl]-6-[(2E)-3-(4-hydroxyphenyl)prop-2-enoyl]-5-oxo-2-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]cyclohex-3-en-1-yl}oxidanesulfonic acid details
3,4,5-trihydroxy-2-[hydroxy(3,4,5-trihydroxyoxan-2-yl)methyl]-6-[(2E)-3-(4-hydroxyphenyl)prop-2-enoyl]-4-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]cyclohex-2-en-1-one → {4,5-dihydroxy-2-[hydroxy({2,3,4-trihydroxy-5-[(2E)-3-(4-hydroxyphenyl)prop-2-enoyl]-6-oxo-3-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]cyclohex-1-en-1-yl})methyl]oxan-3-yl}oxidanesulfonic acid details
3,4,5-trihydroxy-2-[hydroxy(3,4,5-trihydroxyoxan-2-yl)methyl]-6-[(2E)-3-(4-hydroxyphenyl)prop-2-enoyl]-4-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]cyclohex-2-en-1-one → {3,5-dihydroxy-2-[hydroxy({2,3,4-trihydroxy-5-[(2E)-3-(4-hydroxyphenyl)prop-2-enoyl]-6-oxo-3-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]cyclohex-1-en-1-yl})methyl]oxan-4-yl}oxidanesulfonic acid details
3,4,5-trihydroxy-2-[hydroxy(3,4,5-trihydroxyoxan-2-yl)methyl]-6-[(2E)-3-(4-hydroxyphenyl)prop-2-enoyl]-4-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]cyclohex-2-en-1-one → {4,5-dihydroxy-6-[hydroxy({2,3,4-trihydroxy-5-[(2E)-3-(4-hydroxyphenyl)prop-2-enoyl]-6-oxo-3-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]cyclohex-1-en-1-yl})methyl]oxan-3-yl}oxidanesulfonic acid details
3,4,5-trihydroxy-2-[hydroxy(3,4,5-trihydroxyoxan-2-yl)methyl]-6-[(2E)-3-(4-hydroxyphenyl)prop-2-enoyl]-4-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]cyclohex-2-en-1-one → ({2,3,4-trihydroxy-5-[(2E)-3-(4-hydroxyphenyl)prop-2-enoyl]-6-oxo-3-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]cyclohex-1-en-1-yl}(3,4,5-trihydroxyoxan-2-yl)methoxy)sulfonic acid details
3,4,5-trihydroxy-2-[hydroxy(3,4,5-trihydroxyoxan-2-yl)methyl]-6-[(2E)-3-(4-hydroxyphenyl)prop-2-enoyl]-4-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]cyclohex-2-en-1-one → [4,5-dihydroxy-2-(hydroxymethyl)-6-{1,2,6-trihydroxy-3-[hydroxy(3,4,5-trihydroxyoxan-2-yl)methyl]-5-[(2E)-3-(4-hydroxyphenyl)prop-2-enoyl]-4-oxocyclohex-2-en-1-yl}oxan-3-yl]oxidanesulfonic acid details
3,4,5-trihydroxy-2-[hydroxy(3,4,5-trihydroxyoxan-2-yl)methyl]-6-[(2E)-3-(4-hydroxyphenyl)prop-2-enoyl]-4-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]cyclohex-2-en-1-one → [3,5-dihydroxy-2-(hydroxymethyl)-6-{1,2,6-trihydroxy-3-[hydroxy(3,4,5-trihydroxyoxan-2-yl)methyl]-5-[(2E)-3-(4-hydroxyphenyl)prop-2-enoyl]-4-oxocyclohex-2-en-1-yl}oxan-4-yl]oxidanesulfonic acid details
3,4,5-trihydroxy-2-[hydroxy(3,4,5-trihydroxyoxan-2-yl)methyl]-6-[(2E)-3-(4-hydroxyphenyl)prop-2-enoyl]-4-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]cyclohex-2-en-1-one → [4,5-dihydroxy-6-(hydroxymethyl)-2-{1,2,6-trihydroxy-3-[hydroxy(3,4,5-trihydroxyoxan-2-yl)methyl]-5-[(2E)-3-(4-hydroxyphenyl)prop-2-enoyl]-4-oxocyclohex-2-en-1-yl}oxan-3-yl]oxidanesulfonic acid details
3,4,5-trihydroxy-6-[hydroxy(3,4,5-trihydroxyoxan-2-yl)methyl]-2-[(2E)-3-(4-hydroxyphenyl)prop-2-enoyl]-4-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]cyclohex-2-en-1-one → [(3,4,5-trihydroxy-6-{1,2,6-trihydroxy-5-[hydroxy(3,4,5-trihydroxyoxan-2-yl)methyl]-3-[(2E)-3-(4-hydroxyphenyl)prop-2-enoyl]-4-oxocyclohex-2-en-1-yl}oxan-2-yl)methoxy]sulfonic acid details
3,4,5-trihydroxy-6-[hydroxy(3,4,5-trihydroxyoxan-2-yl)methyl]-2-[(2E)-3-(4-hydroxyphenyl)prop-2-enoyl]-4-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]cyclohex-2-en-1-one → {4,5-dihydroxy-2-[hydroxy({4,5,6-trihydroxy-3-[(2E)-3-(4-hydroxyphenyl)prop-2-enoyl]-2-oxo-5-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]cyclohex-3-en-1-yl})methyl]oxan-3-yl}oxidanesulfonic acid details
3,4,5-trihydroxy-6-[hydroxy(3,4,5-trihydroxyoxan-2-yl)methyl]-2-[(2E)-3-(4-hydroxyphenyl)prop-2-enoyl]-4-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]cyclohex-2-en-1-one → {3,5-dihydroxy-2-[hydroxy({4,5,6-trihydroxy-3-[(2E)-3-(4-hydroxyphenyl)prop-2-enoyl]-2-oxo-5-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]cyclohex-3-en-1-yl})methyl]oxan-4-yl}oxidanesulfonic acid details
3,4,5-trihydroxy-6-[hydroxy(3,4,5-trihydroxyoxan-2-yl)methyl]-2-[(2E)-3-(4-hydroxyphenyl)prop-2-enoyl]-4-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]cyclohex-2-en-1-one → {4,5-dihydroxy-6-[hydroxy({4,5,6-trihydroxy-3-[(2E)-3-(4-hydroxyphenyl)prop-2-enoyl]-2-oxo-5-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]cyclohex-3-en-1-yl})methyl]oxan-3-yl}oxidanesulfonic acid details
3,4,5-trihydroxy-6-[hydroxy(3,4,5-trihydroxyoxan-2-yl)methyl]-2-[(2E)-3-(4-hydroxyphenyl)prop-2-enoyl]-4-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]cyclohex-2-en-1-one → ({4,5,6-trihydroxy-3-[(2E)-3-(4-hydroxyphenyl)prop-2-enoyl]-2-oxo-5-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]cyclohex-3-en-1-yl}(3,4,5-trihydroxyoxan-2-yl)methoxy)sulfonic acid details
3,4,5-trihydroxy-6-[hydroxy(3,4,5-trihydroxyoxan-2-yl)methyl]-2-[(2E)-3-(4-hydroxyphenyl)prop-2-enoyl]-4-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]cyclohex-2-en-1-one → {2,3-dihydroxy-6-[hydroxy(3,4,5-trihydroxyoxan-2-yl)methyl]-4-[(2E)-3-(4-hydroxyphenyl)prop-2-enoyl]-5-oxo-2-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]cyclohex-3-en-1-yl}oxidanesulfonic acid details
3,4,5-trihydroxy-6-[hydroxy(3,4,5-trihydroxyoxan-2-yl)methyl]-2-[(2E)-3-(4-hydroxyphenyl)prop-2-enoyl]-4-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]cyclohex-2-en-1-one → [4,5-dihydroxy-2-(hydroxymethyl)-6-{1,2,6-trihydroxy-5-[hydroxy(3,4,5-trihydroxyoxan-2-yl)methyl]-3-[(2E)-3-(4-hydroxyphenyl)prop-2-enoyl]-4-oxocyclohex-2-en-1-yl}oxan-3-yl]oxidanesulfonic acid details
3,4,5-trihydroxy-6-[hydroxy(3,4,5-trihydroxyoxan-2-yl)methyl]-2-[(2E)-3-(4-hydroxyphenyl)prop-2-enoyl]-4-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]cyclohex-2-en-1-one → [3,5-dihydroxy-2-(hydroxymethyl)-6-{1,2,6-trihydroxy-5-[hydroxy(3,4,5-trihydroxyoxan-2-yl)methyl]-3-[(2E)-3-(4-hydroxyphenyl)prop-2-enoyl]-4-oxocyclohex-2-en-1-yl}oxan-4-yl]oxidanesulfonic acid details
3,4,5-trihydroxy-6-[hydroxy(3,4,5-trihydroxyoxan-2-yl)methyl]-2-[(2E)-3-(4-hydroxyphenyl)prop-2-enoyl]-4-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]cyclohex-2-en-1-one → [4,5-dihydroxy-6-(hydroxymethyl)-2-{1,2,6-trihydroxy-5-[hydroxy(3,4,5-trihydroxyoxan-2-yl)methyl]-3-[(2E)-3-(4-hydroxyphenyl)prop-2-enoyl]-4-oxocyclohex-2-en-1-yl}oxan-3-yl]oxidanesulfonic acid details
3,4,5-trihydroxy-2-[hydroxy(3,4,5-trihydroxyoxan-2-yl)methyl]-4-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]cyclohexa-2,5-dien-1-one → [(3,4,5-trihydroxy-6-{1,2,6-trihydroxy-3-[hydroxy(3,4,5-trihydroxyoxan-2-yl)methyl]-4-oxocyclohexa-2,5-dien-1-yl}oxan-2-yl)methoxy]sulfonic acid details
3,4,5-trihydroxy-2-[hydroxy(3,4,5-trihydroxyoxan-2-yl)methyl]-4-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]cyclohexa-2,5-dien-1-one → {4,5-dihydroxy-2-[hydroxy({2,3,4-trihydroxy-6-oxo-3-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]cyclohexa-1,4-dien-1-yl})methyl]oxan-3-yl}oxidanesulfonic acid details
3,4,5-trihydroxy-2-[hydroxy(3,4,5-trihydroxyoxan-2-yl)methyl]-4-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]cyclohexa-2,5-dien-1-one → {3,5-dihydroxy-2-[hydroxy({2,3,4-trihydroxy-6-oxo-3-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]cyclohexa-1,4-dien-1-yl})methyl]oxan-4-yl}oxidanesulfonic acid details
3,4,5-trihydroxy-2-[hydroxy(3,4,5-trihydroxyoxan-2-yl)methyl]-4-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]cyclohexa-2,5-dien-1-one → {4,5-dihydroxy-6-[hydroxy({2,3,4-trihydroxy-6-oxo-3-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]cyclohexa-1,4-dien-1-yl})methyl]oxan-3-yl}oxidanesulfonic acid details
3,4,5-trihydroxy-2-[hydroxy(3,4,5-trihydroxyoxan-2-yl)methyl]-4-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]cyclohexa-2,5-dien-1-one → ({2,3,4-trihydroxy-6-oxo-3-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]cyclohexa-1,4-dien-1-yl}(3,4,5-trihydroxyoxan-2-yl)methoxy)sulfonic acid details
3,4,5-trihydroxy-2-[hydroxy(3,4,5-trihydroxyoxan-2-yl)methyl]-4-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]cyclohexa-2,5-dien-1-one → [4,5-dihydroxy-2-(hydroxymethyl)-6-{1,2,6-trihydroxy-3-[hydroxy(3,4,5-trihydroxyoxan-2-yl)methyl]-4-oxocyclohexa-2,5-dien-1-yl}oxan-3-yl]oxidanesulfonic acid details
3,4,5-trihydroxy-2-[hydroxy(3,4,5-trihydroxyoxan-2-yl)methyl]-4-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]cyclohexa-2,5-dien-1-one → [3,5-dihydroxy-2-(hydroxymethyl)-6-{1,2,6-trihydroxy-3-[hydroxy(3,4,5-trihydroxyoxan-2-yl)methyl]-4-oxocyclohexa-2,5-dien-1-yl}oxan-4-yl]oxidanesulfonic acid details
3,4,5-trihydroxy-2-[hydroxy(3,4,5-trihydroxyoxan-2-yl)methyl]-4-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]cyclohexa-2,5-dien-1-one → [4,5-dihydroxy-6-(hydroxymethyl)-2-{1,2,6-trihydroxy-3-[hydroxy(3,4,5-trihydroxyoxan-2-yl)methyl]-4-oxocyclohexa-2,5-dien-1-yl}oxan-3-yl]oxidanesulfonic acid details
5,6-dihydroxy-4-[hydroxy(3,4,5-trihydroxyoxan-2-yl)methyl]-2-[(2E)-3-(4-hydroxyphenyl)prop-2-enoyl]-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]cyclohex-4-ene-1,3-dione → [(6-{1,2-dihydroxy-3-[hydroxy(3,4,5-trihydroxyoxan-2-yl)methyl]-5-[(2E)-3-(4-hydroxyphenyl)prop-2-enoyl]-4,6-dioxocyclohex-2-en-1-yl}-3,4,5-trihydroxyoxan-2-yl)methoxy]sulfonic acid details
5,6-dihydroxy-4-[hydroxy(3,4,5-trihydroxyoxan-2-yl)methyl]-2-[(2E)-3-(4-hydroxyphenyl)prop-2-enoyl]-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]cyclohex-4-ene-1,3-dione → [2-({2,3-dihydroxy-5-[(2E)-3-(4-hydroxyphenyl)prop-2-enoyl]-4,6-dioxo-3-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]cyclohex-1-en-1-yl}(hydroxy)methyl)-4,5-dihydroxyoxan-3-yl]oxidanesulfonic acid details
5,6-dihydroxy-4-[hydroxy(3,4,5-trihydroxyoxan-2-yl)methyl]-2-[(2E)-3-(4-hydroxyphenyl)prop-2-enoyl]-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]cyclohex-4-ene-1,3-dione → [2-({2,3-dihydroxy-5-[(2E)-3-(4-hydroxyphenyl)prop-2-enoyl]-4,6-dioxo-3-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]cyclohex-1-en-1-yl}(hydroxy)methyl)-3,5-dihydroxyoxan-4-yl]oxidanesulfonic acid details
5,6-dihydroxy-4-[hydroxy(3,4,5-trihydroxyoxan-2-yl)methyl]-2-[(2E)-3-(4-hydroxyphenyl)prop-2-enoyl]-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]cyclohex-4-ene-1,3-dione → [6-({2,3-dihydroxy-5-[(2E)-3-(4-hydroxyphenyl)prop-2-enoyl]-4,6-dioxo-3-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]cyclohex-1-en-1-yl}(hydroxy)methyl)-4,5-dihydroxyoxan-3-yl]oxidanesulfonic acid details
5,6-dihydroxy-4-[hydroxy(3,4,5-trihydroxyoxan-2-yl)methyl]-2-[(2E)-3-(4-hydroxyphenyl)prop-2-enoyl]-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]cyclohex-4-ene-1,3-dione → ({2,3-dihydroxy-5-[(2E)-3-(4-hydroxyphenyl)prop-2-enoyl]-4,6-dioxo-3-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]cyclohex-1-en-1-yl}(3,4,5-trihydroxyoxan-2-yl)methoxy)sulfonic acid details
5,6-dihydroxy-4-[hydroxy(3,4,5-trihydroxyoxan-2-yl)methyl]-2-[(2E)-3-(4-hydroxyphenyl)prop-2-enoyl]-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]cyclohex-4-ene-1,3-dione → (6-{1,2-dihydroxy-3-[hydroxy(3,4,5-trihydroxyoxan-2-yl)methyl]-5-[(2E)-3-(4-hydroxyphenyl)prop-2-enoyl]-4,6-dioxocyclohex-2-en-1-yl}-4,5-dihydroxy-2-(hydroxymethyl)oxan-3-yl)oxidanesulfonic acid details
5,6-dihydroxy-4-[hydroxy(3,4,5-trihydroxyoxan-2-yl)methyl]-2-[(2E)-3-(4-hydroxyphenyl)prop-2-enoyl]-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]cyclohex-4-ene-1,3-dione → (2-{1,2-dihydroxy-3-[hydroxy(3,4,5-trihydroxyoxan-2-yl)methyl]-5-[(2E)-3-(4-hydroxyphenyl)prop-2-enoyl]-4,6-dioxocyclohex-2-en-1-yl}-3,5-dihydroxy-6-(hydroxymethyl)oxan-4-yl)oxidanesulfonic acid details
5,6-dihydroxy-4-[hydroxy(3,4,5-trihydroxyoxan-2-yl)methyl]-2-[(2E)-3-(4-hydroxyphenyl)prop-2-enoyl]-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]cyclohex-4-ene-1,3-dione → (2-{1,2-dihydroxy-3-[hydroxy(3,4,5-trihydroxyoxan-2-yl)methyl]-5-[(2E)-3-(4-hydroxyphenyl)prop-2-enoyl]-4,6-dioxocyclohex-2-en-1-yl}-4,5-dihydroxy-6-(hydroxymethyl)oxan-3-yl)oxidanesulfonic acid details
5,6-dihydroxy-2-[hydroxy(3,4,5-trihydroxyoxan-2-yl)methyl]-4-[(2E)-3-(4-hydroxyphenyl)prop-2-enoyl]-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]cyclohex-4-ene-1,3-dione → [(6-{1,2-dihydroxy-5-[hydroxy(3,4,5-trihydroxyoxan-2-yl)methyl]-3-[(2E)-3-(4-hydroxyphenyl)prop-2-enoyl]-4,6-dioxocyclohex-2-en-1-yl}-3,4,5-trihydroxyoxan-2-yl)methoxy]sulfonic acid details
5,6-dihydroxy-2-[hydroxy(3,4,5-trihydroxyoxan-2-yl)methyl]-4-[(2E)-3-(4-hydroxyphenyl)prop-2-enoyl]-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]cyclohex-4-ene-1,3-dione → [2-({4,5-dihydroxy-3-[(2E)-3-(4-hydroxyphenyl)prop-2-enoyl]-2,6-dioxo-5-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]cyclohex-3-en-1-yl}(hydroxy)methyl)-4,5-dihydroxyoxan-3-yl]oxidanesulfonic acid details
5,6-dihydroxy-2-[hydroxy(3,4,5-trihydroxyoxan-2-yl)methyl]-4-[(2E)-3-(4-hydroxyphenyl)prop-2-enoyl]-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]cyclohex-4-ene-1,3-dione → [2-({4,5-dihydroxy-3-[(2E)-3-(4-hydroxyphenyl)prop-2-enoyl]-2,6-dioxo-5-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]cyclohex-3-en-1-yl}(hydroxy)methyl)-3,5-dihydroxyoxan-4-yl]oxidanesulfonic acid details
5,6-dihydroxy-2-[hydroxy(3,4,5-trihydroxyoxan-2-yl)methyl]-4-[(2E)-3-(4-hydroxyphenyl)prop-2-enoyl]-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]cyclohex-4-ene-1,3-dione → [6-({4,5-dihydroxy-3-[(2E)-3-(4-hydroxyphenyl)prop-2-enoyl]-2,6-dioxo-5-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]cyclohex-3-en-1-yl}(hydroxy)methyl)-4,5-dihydroxyoxan-3-yl]oxidanesulfonic acid details
5,6-dihydroxy-2-[hydroxy(3,4,5-trihydroxyoxan-2-yl)methyl]-4-[(2E)-3-(4-hydroxyphenyl)prop-2-enoyl]-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]cyclohex-4-ene-1,3-dione → ({4,5-dihydroxy-3-[(2E)-3-(4-hydroxyphenyl)prop-2-enoyl]-2,6-dioxo-5-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]cyclohex-3-en-1-yl}(3,4,5-trihydroxyoxan-2-yl)methoxy)sulfonic acid details
5,6-dihydroxy-2-[hydroxy(3,4,5-trihydroxyoxan-2-yl)methyl]-4-[(2E)-3-(4-hydroxyphenyl)prop-2-enoyl]-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]cyclohex-4-ene-1,3-dione → (6-{1,2-dihydroxy-5-[hydroxy(3,4,5-trihydroxyoxan-2-yl)methyl]-3-[(2E)-3-(4-hydroxyphenyl)prop-2-enoyl]-4,6-dioxocyclohex-2-en-1-yl}-4,5-dihydroxy-2-(hydroxymethyl)oxan-3-yl)oxidanesulfonic acid details
5,6-dihydroxy-2-[hydroxy(3,4,5-trihydroxyoxan-2-yl)methyl]-4-[(2E)-3-(4-hydroxyphenyl)prop-2-enoyl]-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]cyclohex-4-ene-1,3-dione → (2-{1,2-dihydroxy-5-[hydroxy(3,4,5-trihydroxyoxan-2-yl)methyl]-3-[(2E)-3-(4-hydroxyphenyl)prop-2-enoyl]-4,6-dioxocyclohex-2-en-1-yl}-3,5-dihydroxy-6-(hydroxymethyl)oxan-4-yl)oxidanesulfonic acid details
5,6-dihydroxy-2-[hydroxy(3,4,5-trihydroxyoxan-2-yl)methyl]-4-[(2E)-3-(4-hydroxyphenyl)prop-2-enoyl]-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]cyclohex-4-ene-1,3-dione → (2-{1,2-dihydroxy-5-[hydroxy(3,4,5-trihydroxyoxan-2-yl)methyl]-3-[(2E)-3-(4-hydroxyphenyl)prop-2-enoyl]-4,6-dioxocyclohex-2-en-1-yl}-4,5-dihydroxy-6-(hydroxymethyl)oxan-3-yl)oxidanesulfonic acid details
Swertiajaponin → ({6-[2-(3,4-dihydroxyphenyl)-5-hydroxy-7-methoxy-4-oxo-4H-chromen-6-yl]-3,4,5-trihydroxyoxan-2-yl}methoxy)sulfonic acid details
Swertiajaponin → {2-[2-(3,4-dihydroxyphenyl)-5-hydroxy-7-methoxy-4-oxo-4H-chromen-6-yl]-4,5-dihydroxy-6-(hydroxymethyl)oxan-3-yl}oxidanesulfonic acid details
Swertiajaponin → {2-[2-(3,4-dihydroxyphenyl)-5-hydroxy-7-methoxy-4-oxo-4H-chromen-6-yl]-3,5-dihydroxy-6-(hydroxymethyl)oxan-4-yl}oxidanesulfonic acid details
Swertiajaponin → {6-[2-(3,4-dihydroxyphenyl)-5-hydroxy-7-methoxy-4-oxo-4H-chromen-6-yl]-4,5-dihydroxy-2-(hydroxymethyl)oxan-3-yl}oxidanesulfonic acid details
5-hydroxy-7-methoxy-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-2-(2,4,5-trihydroxyphenyl)-4H-chromen-4-one → ({3,4,5-trihydroxy-6-[5-hydroxy-7-methoxy-4-oxo-2-(2,4,5-trihydroxyphenyl)-4H-chromen-6-yl]oxan-2-yl}methoxy)sulfonic acid details
5-hydroxy-7-methoxy-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-2-(2,4,5-trihydroxyphenyl)-4H-chromen-4-one → {4,5-dihydroxy-2-[5-hydroxy-7-methoxy-4-oxo-2-(2,4,5-trihydroxyphenyl)-4H-chromen-6-yl]-6-(hydroxymethyl)oxan-3-yl}oxidanesulfonic acid details
5-hydroxy-7-methoxy-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-2-(2,4,5-trihydroxyphenyl)-4H-chromen-4-one → {3,5-dihydroxy-2-[5-hydroxy-7-methoxy-4-oxo-2-(2,4,5-trihydroxyphenyl)-4H-chromen-6-yl]-6-(hydroxymethyl)oxan-4-yl}oxidanesulfonic acid details
5-hydroxy-7-methoxy-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-2-(2,4,5-trihydroxyphenyl)-4H-chromen-4-one → {4,5-dihydroxy-6-[5-hydroxy-7-methoxy-4-oxo-2-(2,4,5-trihydroxyphenyl)-4H-chromen-6-yl]-2-(hydroxymethyl)oxan-3-yl}oxidanesulfonic acid details
2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → ({6-[2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-4-oxo-4H-chromen-6-yl]-3,4,5-trihydroxyoxan-2-yl}methoxy)sulfonic acid details
2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → {2-[2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-4-oxo-4H-chromen-6-yl]-4,5-dihydroxy-6-(hydroxymethyl)oxan-3-yl}oxidanesulfonic acid details
2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → {2-[2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-4-oxo-4H-chromen-6-yl]-3,5-dihydroxy-6-(hydroxymethyl)oxan-4-yl}oxidanesulfonic acid details
2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → {6-[2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-4-oxo-4H-chromen-6-yl]-4,5-dihydroxy-2-(hydroxymethyl)oxan-3-yl}oxidanesulfonic acid details
5-hydroxy-2-(3-hydroxyphenyl)-7-methoxy-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → ({3,4,5-trihydroxy-6-[5-hydroxy-2-(3-hydroxyphenyl)-7-methoxy-4-oxo-4H-chromen-6-yl]oxan-2-yl}methoxy)sulfonic acid details
5-hydroxy-2-(3-hydroxyphenyl)-7-methoxy-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → {4,5-dihydroxy-2-[5-hydroxy-2-(3-hydroxyphenyl)-7-methoxy-4-oxo-4H-chromen-6-yl]-6-(hydroxymethyl)oxan-3-yl}oxidanesulfonic acid details
5-hydroxy-2-(3-hydroxyphenyl)-7-methoxy-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → {3,5-dihydroxy-2-[5-hydroxy-2-(3-hydroxyphenyl)-7-methoxy-4-oxo-4H-chromen-6-yl]-6-(hydroxymethyl)oxan-4-yl}oxidanesulfonic acid details
5-hydroxy-2-(3-hydroxyphenyl)-7-methoxy-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → {4,5-dihydroxy-6-[5-hydroxy-2-(3-hydroxyphenyl)-7-methoxy-4-oxo-4H-chromen-6-yl]-2-(hydroxymethyl)oxan-3-yl}oxidanesulfonic acid details
5,7-dihydroxy-2-(3-hydroxyphenyl)-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → ({6-[5,7-dihydroxy-2-(3-hydroxyphenyl)-4-oxo-4H-chromen-6-yl]-3,4,5-trihydroxyoxan-2-yl}methoxy)sulfonic acid details
5,7-dihydroxy-2-(3-hydroxyphenyl)-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → {2-[5,7-dihydroxy-2-(3-hydroxyphenyl)-4-oxo-4H-chromen-6-yl]-4,5-dihydroxy-6-(hydroxymethyl)oxan-3-yl}oxidanesulfonic acid details
5,7-dihydroxy-2-(3-hydroxyphenyl)-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → {2-[5,7-dihydroxy-2-(3-hydroxyphenyl)-4-oxo-4H-chromen-6-yl]-3,5-dihydroxy-6-(hydroxymethyl)oxan-4-yl}oxidanesulfonic acid details
5,7-dihydroxy-2-(3-hydroxyphenyl)-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → {6-[5,7-dihydroxy-2-(3-hydroxyphenyl)-4-oxo-4H-chromen-6-yl]-4,5-dihydroxy-2-(hydroxymethyl)oxan-3-yl}oxidanesulfonic acid details
2'-Hydroxyisoorientin → ({6-[5,7-dihydroxy-4-oxo-2-(2,4,5-trihydroxyphenyl)-4H-chromen-6-yl]-3,4,5-trihydroxyoxan-2-yl}methoxy)sulfonic acid details
2'-Hydroxyisoorientin → {2-[5,7-dihydroxy-4-oxo-2-(2,4,5-trihydroxyphenyl)-4H-chromen-6-yl]-4,5-dihydroxy-6-(hydroxymethyl)oxan-3-yl}oxidanesulfonic acid details
2'-Hydroxyisoorientin → {2-[5,7-dihydroxy-4-oxo-2-(2,4,5-trihydroxyphenyl)-4H-chromen-6-yl]-3,5-dihydroxy-6-(hydroxymethyl)oxan-4-yl}oxidanesulfonic acid details
2'-Hydroxyisoorientin → {6-[5,7-dihydroxy-4-oxo-2-(2,4,5-trihydroxyphenyl)-4H-chromen-6-yl]-4,5-dihydroxy-2-(hydroxymethyl)oxan-3-yl}oxidanesulfonic acid details
3-(hydroxymethyl)-1H-isochromen-1-one → [(1-oxo-1H-isochromen-3-yl)methoxy]sulfonic acid details
7-hydroxy-3-(hydroxymethyl)-1H-isochromen-1-one → [(7-hydroxy-1-oxo-1H-isochromen-3-yl)methoxy]sulfonic acid details
6-hydroxy-3-(hydroxymethyl)-1H-isochromen-1-one → [(6-hydroxy-1-oxo-1H-isochromen-3-yl)methoxy]sulfonic acid details
5-hydroxy-3-(hydroxymethyl)-1H-isochromen-1-one → [(5-hydroxy-1-oxo-1H-isochromen-3-yl)methoxy]sulfonic acid details
7-hydroxy-6-(4-hydroxy-3-methylbut-2-en-1-yl)-8-methoxy-2H-chromen-2-one → {[4-(7-hydroxy-8-methoxy-2-oxo-2H-chromen-6-yl)-2-methylbut-2-en-1-yl]oxy}sulfonic acid details
3-(6,7-dimethoxy-2H-1,3-benzodioxol-5-yl)prop-2-en-1-ol → {[3-(6,7-dimethoxy-2H-1,3-benzodioxol-5-yl)prop-2-en-1-yl]oxy}sulfonic acid details
3-(6,7-dimethoxy-2H-1,3-benzodioxol-5-yl)-3-hydroxypropanal → [1-(6,7-dimethoxy-2H-1,3-benzodioxol-5-yl)-3-oxopropoxy]sulfonic acid details
3-(6,7-dimethoxy-2H-1,3-benzodioxol-5-yl)-2-hydroxypropanal → {[1-(6,7-dimethoxy-2H-1,3-benzodioxol-5-yl)-3-oxopropan-2-yl]oxy}sulfonic acid details
3-(6,7-dimethoxy-2H-1,3-benzodioxol-5-yl)propan-1-ol → [3-(6,7-dimethoxy-2H-1,3-benzodioxol-5-yl)propoxy]sulfonic acid details
6-(3-hydroxyprop-1-en-1-yl)-4-methoxy-2H-1,3-benzodioxol-5-ol → {[3-(6-hydroxy-7-methoxy-2H-1,3-benzodioxol-5-yl)prop-2-en-1-yl]oxy}sulfonic acid details
6-(3-hydroxyprop-1-en-1-yl)-5-methoxy-2H-1,3-benzodioxol-4-ol → {[3-(7-hydroxy-6-methoxy-2H-1,3-benzodioxol-5-yl)prop-2-en-1-yl]oxy}sulfonic acid details
[3-(6,7-dimethoxy-2H-1,3-benzodioxol-5-yl)oxiran-2-yl]methanol → {[3-(6,7-dimethoxy-2H-1,3-benzodioxol-5-yl)oxiran-2-yl]methoxy}sulfonic acid details
5-(3-hydroxyprop-1-en-1-yl)-3,4-dimethoxybenzene-1,2-diol → {[3-(4,5-dihydroxy-2,3-dimethoxyphenyl)prop-2-en-1-yl]oxy}sulfonic acid details
Silidianin → {5,7-dihydroxy-2-[3-hydroxy-10-(4-hydroxy-3-methoxyphenyl)-2-oxo-4-oxatricyclo[4.3.1.0³,⁷]decan-8-yl]-4-oxo-3,4-dihydro-2H-1-benzopyran-3-yl}oxidanesulfonic acid details
3-hydroxy-10-(3-methoxyphenyl)-8-(3,5,7-trihydroxy-4-oxo-3,4-dihydro-2H-1-benzopyran-2-yl)-4-oxatricyclo[4.3.1.0³,⁷]decan-2-one → {5,7-dihydroxy-2-[3-hydroxy-10-(3-methoxyphenyl)-2-oxo-4-oxatricyclo[4.3.1.0³,⁷]decan-8-yl]-4-oxo-3,4-dihydro-2H-1-benzopyran-3-yl}oxidanesulfonic acid details
3,5,6,7-tetrahydroxy-2-(4-hydroxy-3-methoxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-one → [5,6,7-trihydroxy-2-(4-hydroxy-3-methoxyphenyl)-4-oxo-3,4-dihydro-2H-1-benzopyran-3-yl]oxidanesulfonic acid details
3,5,6,7-tetrahydroxy-2-(3-methoxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-one → [5,6,7-trihydroxy-2-(3-methoxyphenyl)-4-oxo-3,4-dihydro-2H-1-benzopyran-3-yl]oxidanesulfonic acid details
2-(3,4-dihydroxyphenyl)-3,5,7-trihydroxy-6-methoxy-3,4-dihydro-2H-1-benzopyran-4-one → [2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-6-methoxy-4-oxo-3,4-dihydro-2H-1-benzopyran-3-yl]oxidanesulfonic acid details
3,5,7-trihydroxy-2-(3-hydroxyphenyl)-6-methoxy-3,4-dihydro-2H-1-benzopyran-4-one → [5,7-dihydroxy-2-(3-hydroxyphenyl)-6-methoxy-4-oxo-3,4-dihydro-2H-1-benzopyran-3-yl]oxidanesulfonic acid details
4-hydroxy-11,15-dimethoxy-6,8,20-trioxapentacyclo[10.8.0.0²,⁹.0³,⁷.0¹⁴,¹⁹]icosa-1(12),2(9),10,14,16,18-hexaen-13-one → {11,15-dimethoxy-13-oxo-6,8,20-trioxapentacyclo[10.8.0.0²,⁹.0³,⁷.0¹⁴,¹⁹]icosa-1(12),2(9),10,14,16,18-hexaen-4-yl}oxidanesulfonic acid details
2-{9-hydroxy-2-oxo-2H,8H,9H-furo[2,3-h]chromen-8-yl}propan-2-yl 3-methylbut-2-enoate → (8-{2-[(3-methylbut-2-enoyl)oxy]propan-2-yl}-2-oxo-2H,8H,9H-furo[2,3-h]chromen-9-yl)oxidanesulfonic acid details
1-hydroxy-2-{9-[(3-methylbut-2-enoyl)oxy]-2-oxo-2H,8H,9H-furo[2,3-h]chromen-8-yl}propan-2-yl 3-methylbut-2-enoate → {2-[(3-methylbut-2-enoyl)oxy]-2-{9-[(3-methylbut-2-enoyl)oxy]-2-oxo-2H,8H,9H-furo[2,3-h]chromen-8-yl}propoxy}sulfonic acid details
8-(1,2-dihydroxypropan-2-yl)-2-oxo-2H,8H,9H-furo[2,3-h]chromen-9-yl 3-methylbut-2-enoate → (2-hydroxy-2-{9-[(3-methylbut-2-enoyl)oxy]-2-oxo-2H,8H,9H-furo[2,3-h]chromen-8-yl}propoxy)sulfonic acid details
4-hydroxy-3-methylbut-2-enoic acid → 3-methyl-4-(sulfooxy)but-2-enoic acid details
1-hydroxy-2-{9-hydroxy-2-oxo-2H,8H,9H-furo[2,3-h]chromen-8-yl}propan-2-yl 3-methylbut-2-enoate → (2-{9-hydroxy-2-oxo-2H,8H,9H-furo[2,3-h]chromen-8-yl}-2-[(3-methylbut-2-enoyl)oxy]propoxy)sulfonic acid details
1-hydroxy-2-{9-hydroxy-2-oxo-2H,8H,9H-furo[2,3-h]chromen-8-yl}propan-2-yl 3-methylbut-2-enoate → (8-{1-hydroxy-2-[(3-methylbut-2-enoyl)oxy]propan-2-yl}-2-oxo-2H,8H,9H-furo[2,3-h]chromen-9-yl)oxidanesulfonic acid details
6-(4-hydroxy-3-oxobut-1-en-1-yl)-7-methoxy-2H-chromen-2-one → {[4-(7-methoxy-2-oxo-2H-chromen-6-yl)-2-oxobut-3-en-1-yl]oxy}sulfonic acid details
6-(3-hydroxybut-1-en-1-yl)-7-methoxy-2H-chromen-2-one → {[4-(7-methoxy-2-oxo-2H-chromen-6-yl)but-3-en-2-yl]oxy}sulfonic acid details
6-(1-hydroxy-3-oxobutyl)-7-methoxy-2H-chromen-2-one → [1-(7-methoxy-2-oxo-2H-chromen-6-yl)-3-oxobutoxy]sulfonic acid details
6-(4-hydroxy-3-oxobutyl)-7-methoxy-2H-chromen-2-one → [4-(7-methoxy-2-oxo-2H-chromen-6-yl)-2-oxobutoxy]sulfonic acid details
6-(2-hydroxy-3-oxobutyl)-7-methoxy-2H-chromen-2-one → {[1-(7-methoxy-2-oxo-2H-chromen-6-yl)-3-oxobutan-2-yl]oxy}sulfonic acid details
6-(3-hydroxybutyl)-7-methoxy-2H-chromen-2-one → {[4-(7-methoxy-2-oxo-2H-chromen-6-yl)butan-2-yl]oxy}sulfonic acid details
2-[(1E)-4-hydroxy-3-methylbut-1-en-1-yl]-5-[(E)-2-(4-hydroxyphenyl)ethenyl]benzene-1,3-diol → {[(3E)-4-{2,6-dihydroxy-4-[(E)-2-(4-hydroxyphenyl)ethenyl]phenyl}-2-methylbut-3-en-1-yl]oxy}sulfonic acid details
5-[(E)-2-(3,4-dihydroxyphenyl)ethenyl]-2-[(1E)-4-hydroxy-3-methylbut-1-en-1-yl]benzene-1,3-diol → {[(3E)-4-{4-[(E)-2-(3,4-dihydroxyphenyl)ethenyl]-2,6-dihydroxyphenyl}-2-methylbut-3-en-1-yl]oxy}sulfonic acid details
2-{9-hydroxy-2-oxo-2H,8H,9H-furo[2,3-h]chromen-8-yl}propan-2-yl acetate → {8-[2-(acetyloxy)propan-2-yl]-2-oxo-2H,8H,9H-furo[2,3-h]chromen-9-yl}oxidanesulfonic acid details
8-[2-(acetyloxy)-1-hydroxypropan-2-yl]-2-oxo-2H,8H,9H-furo[2,3-h]chromen-9-yl (2E)-2-methylbut-2-enoate → [2-(acetyloxy)-2-(9-{[(2E)-2-methylbut-2-enoyl]oxy}-2-oxo-2H,8H,9H-furo[2,3-h]chromen-8-yl)propoxy]sulfonic acid details
8-{2-[(2-hydroxyacetyl)oxy]propan-2-yl}-2-oxo-2H,8H,9H-furo[2,3-h]chromen-9-yl (2E)-2-methylbut-2-enoate → (2-{[2-(9-{[(2E)-2-methylbut-2-enoyl]oxy}-2-oxo-2H,8H,9H-furo[2,3-h]chromen-8-yl)propan-2-yl]oxy}-2-oxoethoxy)sulfonic acid details
8-(1,2-dihydroxypropan-2-yl)-2-oxo-2H,8H,9H-furo[2,3-h]chromen-9-yl (2E)-2-methylbut-2-enoate → [2-hydroxy-2-(9-{[(2E)-2-methylbut-2-enoyl]oxy}-2-oxo-2H,8H,9H-furo[2,3-h]chromen-8-yl)propoxy]sulfonic acid details
Glycolic acid → 2-(sulfooxy)acetic acid details
(2Z)-2-(hydroxymethyl)but-2-enoic acid → (2Z)-2-[(sulfooxy)methyl]but-2-enoic acid details
4-hydroxy-2-methylbut-2-enoic acid → 2-methyl-4-(sulfooxy)but-2-enoic acid details
Vescalin → ({7,8,9,12,13,14,17,18,19,25,29-undecahydroxy-4,22,27-trioxo-3,23,26-trioxahexacyclo[13.10.3.1²,⁶.0⁵,¹⁰.0¹¹,²⁸.0¹⁶,²¹]nonacosa-5(10),6,8,11,13,15(28),16,18,20-nonaen-24-yl}methoxy)sulfonic acid details
Vescalin → [7,8,9,12,13,14,17,18,19,29-decahydroxy-24-(hydroxymethyl)-4,22,27-trioxo-3,23,26-trioxahexacyclo[13.10.3.1²,⁶.0⁵,¹⁰.0¹¹,²⁸.0¹⁶,²¹]nonacosa-5(10),6,8,11,13,15(28),16,18,20-nonaen-25-yl]oxidanesulfonic acid details
Vescalin → [7,8,9,12,13,14,17,18,19,25-decahydroxy-24-(hydroxymethyl)-4,22,27-trioxo-3,23,26-trioxahexacyclo[13.10.3.1²,⁶.0⁵,¹⁰.0¹¹,²⁸.0¹⁶,²¹]nonacosa-5(10),6,8,11,13,15(28),16,18,20-nonaen-29-yl]oxidanesulfonic acid details
Orientin → ({6-[2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-4-oxo-4H-chromen-8-yl]-3,4,5-trihydroxyoxan-2-yl}methoxy)sulfonic acid details
Orientin → {6-[2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-4-oxo-4H-chromen-8-yl]-4,5-dihydroxy-2-(hydroxymethyl)oxan-3-yl}oxidanesulfonic acid details
Orientin → {2-[2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-4-oxo-4H-chromen-8-yl]-3,5-dihydroxy-6-(hydroxymethyl)oxan-4-yl}oxidanesulfonic acid details
Orientin → {2-[2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-4-oxo-4H-chromen-8-yl]-4,5-dihydroxy-6-(hydroxymethyl)oxan-3-yl}oxidanesulfonic acid details
2-(3,4-dihydroxyphenyl)-5,6,7-trihydroxy-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → ({6-[2-(3,4-dihydroxyphenyl)-5,6,7-trihydroxy-4-oxo-4H-chromen-8-yl]-3,4,5-trihydroxyoxan-2-yl}methoxy)sulfonic acid details
2-(3,4-dihydroxyphenyl)-5,6,7-trihydroxy-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → {6-[2-(3,4-dihydroxyphenyl)-5,6,7-trihydroxy-4-oxo-4H-chromen-8-yl]-4,5-dihydroxy-2-(hydroxymethyl)oxan-3-yl}oxidanesulfonic acid details
2-(3,4-dihydroxyphenyl)-5,6,7-trihydroxy-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → {2-[2-(3,4-dihydroxyphenyl)-5,6,7-trihydroxy-4-oxo-4H-chromen-8-yl]-3,5-dihydroxy-6-(hydroxymethyl)oxan-4-yl}oxidanesulfonic acid details
2-(3,4-dihydroxyphenyl)-5,6,7-trihydroxy-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → {2-[2-(3,4-dihydroxyphenyl)-5,6,7-trihydroxy-4-oxo-4H-chromen-8-yl]-4,5-dihydroxy-6-(hydroxymethyl)oxan-3-yl}oxidanesulfonic acid details
5,7-dihydroxy-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-2-(2,4,5-trihydroxyphenyl)-4H-chromen-4-one → ({6-[5,7-dihydroxy-4-oxo-2-(2,4,5-trihydroxyphenyl)-4H-chromen-8-yl]-3,4,5-trihydroxyoxan-2-yl}methoxy)sulfonic acid details
5,7-dihydroxy-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-2-(2,4,5-trihydroxyphenyl)-4H-chromen-4-one → {6-[5,7-dihydroxy-4-oxo-2-(2,4,5-trihydroxyphenyl)-4H-chromen-8-yl]-4,5-dihydroxy-2-(hydroxymethyl)oxan-3-yl}oxidanesulfonic acid details
5,7-dihydroxy-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-2-(2,4,5-trihydroxyphenyl)-4H-chromen-4-one → {2-[5,7-dihydroxy-4-oxo-2-(2,4,5-trihydroxyphenyl)-4H-chromen-8-yl]-3,5-dihydroxy-6-(hydroxymethyl)oxan-4-yl}oxidanesulfonic acid details
5,7-dihydroxy-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-2-(2,4,5-trihydroxyphenyl)-4H-chromen-4-one → {2-[5,7-dihydroxy-4-oxo-2-(2,4,5-trihydroxyphenyl)-4H-chromen-8-yl]-4,5-dihydroxy-6-(hydroxymethyl)oxan-3-yl}oxidanesulfonic acid details
5,7-dihydroxy-2-(3-hydroxyphenyl)-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → ({6-[5,7-dihydroxy-2-(3-hydroxyphenyl)-4-oxo-4H-chromen-8-yl]-3,4,5-trihydroxyoxan-2-yl}methoxy)sulfonic acid details
5,7-dihydroxy-2-(3-hydroxyphenyl)-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → {6-[5,7-dihydroxy-2-(3-hydroxyphenyl)-4-oxo-4H-chromen-8-yl]-4,5-dihydroxy-2-(hydroxymethyl)oxan-3-yl}oxidanesulfonic acid details
5,7-dihydroxy-2-(3-hydroxyphenyl)-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → {2-[5,7-dihydroxy-2-(3-hydroxyphenyl)-4-oxo-4H-chromen-8-yl]-3,5-dihydroxy-6-(hydroxymethyl)oxan-4-yl}oxidanesulfonic acid details
5,7-dihydroxy-2-(3-hydroxyphenyl)-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → {2-[5,7-dihydroxy-2-(3-hydroxyphenyl)-4-oxo-4H-chromen-8-yl]-4,5-dihydroxy-6-(hydroxymethyl)oxan-3-yl}oxidanesulfonic acid details
5,6,7-trihydroxy-2-(3-hydroxyphenyl)-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → ({3,4,5-trihydroxy-6-[5,6,7-trihydroxy-2-(3-hydroxyphenyl)-4-oxo-4H-chromen-8-yl]oxan-2-yl}methoxy)sulfonic acid details
5,6,7-trihydroxy-2-(3-hydroxyphenyl)-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → [4,5-dihydroxy-2-(hydroxymethyl)-6-[5,6,7-trihydroxy-2-(3-hydroxyphenyl)-4-oxo-4H-chromen-8-yl]oxan-3-yl]oxidanesulfonic acid details
5,6,7-trihydroxy-2-(3-hydroxyphenyl)-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → [3,5-dihydroxy-2-(hydroxymethyl)-6-[5,6,7-trihydroxy-2-(3-hydroxyphenyl)-4-oxo-4H-chromen-8-yl]oxan-4-yl]oxidanesulfonic acid details
5,6,7-trihydroxy-2-(3-hydroxyphenyl)-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → [4,5-dihydroxy-6-(hydroxymethyl)-2-[5,6,7-trihydroxy-2-(3-hydroxyphenyl)-4-oxo-4H-chromen-8-yl]oxan-3-yl]oxidanesulfonic acid details
8-(1-hydroxy-2-methoxypropan-2-yl)-2H-furo[2,3-h]chromen-2-one → (2-methoxy-2-{2-oxo-2H-furo[2,3-h]chromen-8-yl}propoxy)sulfonic acid details
3-(2H-1,3-benzodioxol-5-yl)-3-hydroxy-1-(4-methoxy-1-benzofuran-5-yl)propan-1-one → [1-(2H-1,3-benzodioxol-5-yl)-3-(4-methoxy-1-benzofuran-5-yl)-3-oxopropoxy]sulfonic acid details
1-(2H-1,3-benzodioxol-5-yl)-3-hydroxy-3-(4-methoxy-1-benzofuran-5-yl)propan-1-one → [3-(2H-1,3-benzodioxol-5-yl)-1-(4-methoxy-1-benzofuran-5-yl)-3-oxopropoxy]sulfonic acid details
1-(4-methoxy-1-benzofuran-5-yl)ethan-1-ol → [1-(4-methoxy-1-benzofuran-5-yl)ethoxy]sulfonic acid details
4-{[3-(hydroxymethyl)-3-methyloxiran-2-yl]methoxy}-7H-furo[3,2-g]chromen-7-one → ({2-methyl-3-[({7-oxo-7H-furo[3,2-g]chromen-4-yl}oxy)methyl]oxiran-2-yl}methoxy)sulfonic acid details
2-(3,4-dihydroxyphenyl)-3,5,6,7-tetrahydroxy-3,4-dihydro-2H-1-benzopyran-4-one → [2-(3,4-dihydroxyphenyl)-5,6,7-trihydroxy-4-oxo-3,4-dihydro-2H-1-benzopyran-3-yl]oxidanesulfonic acid details
3,5,6,7-tetrahydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-one → [5,6,7-trihydroxy-2-(3-hydroxyphenyl)-4-oxo-3,4-dihydro-2H-1-benzopyran-3-yl]oxidanesulfonic acid details
3,5,6,7-tetrahydroxy-2-(3,4,5-trihydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-one → [5,6,7-trihydroxy-4-oxo-2-(3,4,5-trihydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-3-yl]oxidanesulfonic acid details
2-(3,5-dihydroxyphenyl)-3,5,6,7-tetrahydroxy-3,4-dihydro-2H-1-benzopyran-4-one → [2-(3,5-dihydroxyphenyl)-5,6,7-trihydroxy-4-oxo-3,4-dihydro-2H-1-benzopyran-3-yl]oxidanesulfonic acid details
3,5,6,7-tetrahydroxy-2-(2,3,4-trihydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-one → [5,6,7-trihydroxy-4-oxo-2-(2,3,4-trihydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-3-yl]oxidanesulfonic acid details
3,5,6,7-tetrahydroxy-2-(2,4,5-trihydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-one → [5,6,7-trihydroxy-4-oxo-2-(2,4,5-trihydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-3-yl]oxidanesulfonic acid details
Castacrenin A → [2-hydroxy-2-(5,11,12,13-tetrahydroxy-8-oxo-10-{6,7,13,14-tetrahydroxy-3,10-dioxo-2,9-dioxatetracyclo[6.6.2.0⁴,¹⁶.0¹¹,¹⁵]hexadeca-1(15),4,6,8(16),11,13-hexaen-5-yl}-3,7-dioxatricyclo[7.4.0.0²,⁶]trideca-1(13),9,11-trien-4-yl)ethoxy]sulfonic acid details
Castacrenin A → [4-(1,2-dihydroxyethyl)-11,12,13-trihydroxy-8-oxo-10-{6,7,13,14-tetrahydroxy-3,10-dioxo-2,9-dioxatetracyclo[6.6.2.0⁴,¹⁶.0¹¹,¹⁵]hexadeca-1(15),4,6,8(16),11,13-hexaen-5-yl}-3,7-dioxatricyclo[7.4.0.0²,⁶]trideca-1(13),9,11-trien-5-yl]oxidanesulfonic acid details
Castacrenin A → [2-hydroxy-1-(5,11,12,13-tetrahydroxy-8-oxo-10-{6,7,13,14-tetrahydroxy-3,10-dioxo-2,9-dioxatetracyclo[6.6.2.0⁴,¹⁶.0¹¹,¹⁵]hexadeca-1(15),4,6,8(16),11,13-hexaen-5-yl}-3,7-dioxatricyclo[7.4.0.0²,⁶]trideca-1(13),9,11-trien-4-yl)ethoxy]sulfonic acid details
7-[4-(1,2-dihydroxyethyl)-5,11,12,13-tetrahydroxy-8-oxo-3,7-dioxatricyclo[7.4.0.0²,⁶]trideca-1(13),9,11-trien-10-yl]-3,4,8,9,10-pentahydroxy-6-oxo-6H-benzo[c]chromene-1-carboxylic acid → 3,4,8,9,10-pentahydroxy-6-oxo-7-{5,11,12,13-tetrahydroxy-4-[1-hydroxy-2-(sulfooxy)ethyl]-8-oxo-3,7-dioxatricyclo[7.4.0.0²,⁶]trideca-1(13),9,11-trien-10-yl}-6H-benzo[c]chromene-1-carboxylic acid details
7-[4-(1,2-dihydroxyethyl)-5,11,12,13-tetrahydroxy-8-oxo-3,7-dioxatricyclo[7.4.0.0²,⁶]trideca-1(13),9,11-trien-10-yl]-3,4,8,9,10-pentahydroxy-6-oxo-6H-benzo[c]chromene-1-carboxylic acid → 7-[4-(1,2-dihydroxyethyl)-11,12,13-trihydroxy-8-oxo-5-(sulfooxy)-3,7-dioxatricyclo[7.4.0.0²,⁶]trideca-1(13),9,11-trien-10-yl]-3,4,8,9,10-pentahydroxy-6-oxo-6H-benzo[c]chromene-1-carboxylic acid details
7-[4-(1,2-dihydroxyethyl)-5,11,12,13-tetrahydroxy-8-oxo-3,7-dioxatricyclo[7.4.0.0²,⁶]trideca-1(13),9,11-trien-10-yl]-3,4,8,9,10-pentahydroxy-6-oxo-6H-benzo[c]chromene-1-carboxylic acid → 3,4,8,9,10-pentahydroxy-6-oxo-7-{5,11,12,13-tetrahydroxy-4-[2-hydroxy-1-(sulfooxy)ethyl]-8-oxo-3,7-dioxatricyclo[7.4.0.0²,⁶]trideca-1(13),9,11-trien-10-yl}-6H-benzo[c]chromene-1-carboxylic acid details
2-[4-(1,2-dihydroxyethyl)-5,11,12,13-tetrahydroxy-8-oxo-3,7-dioxatricyclo[7.4.0.0²,⁶]trideca-1(13),9,11-trien-10-yl]-3,4,8,9,10-pentahydroxy-6-oxo-6H-benzo[c]chromene-1-carboxylic acid → 3,4,8,9,10-pentahydroxy-6-oxo-2-{5,11,12,13-tetrahydroxy-4-[1-hydroxy-2-(sulfooxy)ethyl]-8-oxo-3,7-dioxatricyclo[7.4.0.0²,⁶]trideca-1(13),9,11-trien-10-yl}-6H-benzo[c]chromene-1-carboxylic acid details
2-[4-(1,2-dihydroxyethyl)-5,11,12,13-tetrahydroxy-8-oxo-3,7-dioxatricyclo[7.4.0.0²,⁶]trideca-1(13),9,11-trien-10-yl]-3,4,8,9,10-pentahydroxy-6-oxo-6H-benzo[c]chromene-1-carboxylic acid → 2-[4-(1,2-dihydroxyethyl)-11,12,13-trihydroxy-8-oxo-5-(sulfooxy)-3,7-dioxatricyclo[7.4.0.0²,⁶]trideca-1(13),9,11-trien-10-yl]-3,4,8,9,10-pentahydroxy-6-oxo-6H-benzo[c]chromene-1-carboxylic acid details
2-[4-(1,2-dihydroxyethyl)-5,11,12,13-tetrahydroxy-8-oxo-3,7-dioxatricyclo[7.4.0.0²,⁶]trideca-1(13),9,11-trien-10-yl]-3,4,8,9,10-pentahydroxy-6-oxo-6H-benzo[c]chromene-1-carboxylic acid → 3,4,8,9,10-pentahydroxy-6-oxo-2-{5,11,12,13-tetrahydroxy-4-[2-hydroxy-1-(sulfooxy)ethyl]-8-oxo-3,7-dioxatricyclo[7.4.0.0²,⁶]trideca-1(13),9,11-trien-10-yl}-6H-benzo[c]chromene-1-carboxylic acid details
Castacrenin B → [(5,6,12,13,14-pentahydroxy-9-oxo-11-{6,7,13,14-tetrahydroxy-3,10-dioxo-2,9-dioxatetracyclo[6.6.2.0⁴,¹⁶.0¹¹,¹⁵]hexadeca-1(15),4,6,8(16),11,13-hexaen-5-yl}-3,8-dioxatricyclo[8.4.0.0²,⁷]tetradeca-1(14),10,12-trien-4-yl)methoxy]sulfonic acid details
Castacrenin B → [6,12,13,14-tetrahydroxy-4-(hydroxymethyl)-9-oxo-11-{6,7,13,14-tetrahydroxy-3,10-dioxo-2,9-dioxatetracyclo[6.6.2.0⁴,¹⁶.0¹¹,¹⁵]hexadeca-1(15),4,6,8(16),11,13-hexaen-5-yl}-3,8-dioxatricyclo[8.4.0.0²,⁷]tetradeca-1(14),10,12-trien-5-yl]oxidanesulfonic acid details
Castacrenin B → [5,12,13,14-tetrahydroxy-4-(hydroxymethyl)-9-oxo-11-{6,7,13,14-tetrahydroxy-3,10-dioxo-2,9-dioxatetracyclo[6.6.2.0⁴,¹⁶.0¹¹,¹⁵]hexadeca-1(15),4,6,8(16),11,13-hexaen-5-yl}-3,8-dioxatricyclo[8.4.0.0²,⁷]tetradeca-1(14),10,12-trien-6-yl]oxidanesulfonic acid details
3,4,8,9,10-pentahydroxy-6-oxo-7-[5,6,12,13,14-pentahydroxy-4-(hydroxymethyl)-9-oxo-3,8-dioxatricyclo[8.4.0.0²,⁷]tetradeca-1(14),10,12-trien-11-yl]-6H-benzo[c]chromene-1-carboxylic acid → 3,4,8,9,10-pentahydroxy-6-oxo-7-{5,6,12,13,14-pentahydroxy-9-oxo-4-[(sulfooxy)methyl]-3,8-dioxatricyclo[8.4.0.0²,⁷]tetradeca-1(14),10,12-trien-11-yl}-6H-benzo[c]chromene-1-carboxylic acid details
3,4,8,9,10-pentahydroxy-6-oxo-7-[5,6,12,13,14-pentahydroxy-4-(hydroxymethyl)-9-oxo-3,8-dioxatricyclo[8.4.0.0²,⁷]tetradeca-1(14),10,12-trien-11-yl]-6H-benzo[c]chromene-1-carboxylic acid → 3,4,8,9,10-pentahydroxy-6-oxo-7-[6,12,13,14-tetrahydroxy-4-(hydroxymethyl)-9-oxo-5-(sulfooxy)-3,8-dioxatricyclo[8.4.0.0²,⁷]tetradeca-1(14),10,12-trien-11-yl]-6H-benzo[c]chromene-1-carboxylic acid details
3,4,8,9,10-pentahydroxy-6-oxo-7-[5,6,12,13,14-pentahydroxy-4-(hydroxymethyl)-9-oxo-3,8-dioxatricyclo[8.4.0.0²,⁷]tetradeca-1(14),10,12-trien-11-yl]-6H-benzo[c]chromene-1-carboxylic acid → 3,4,8,9,10-pentahydroxy-6-oxo-7-[5,12,13,14-tetrahydroxy-4-(hydroxymethyl)-9-oxo-6-(sulfooxy)-3,8-dioxatricyclo[8.4.0.0²,⁷]tetradeca-1(14),10,12-trien-11-yl]-6H-benzo[c]chromene-1-carboxylic acid details
3,4,8,9,10-pentahydroxy-6-oxo-2-[5,6,12,13,14-pentahydroxy-4-(hydroxymethyl)-9-oxo-3,8-dioxatricyclo[8.4.0.0²,⁷]tetradeca-1(14),10,12-trien-11-yl]-6H-benzo[c]chromene-1-carboxylic acid → 3,4,8,9,10-pentahydroxy-6-oxo-2-{5,6,12,13,14-pentahydroxy-9-oxo-4-[(sulfooxy)methyl]-3,8-dioxatricyclo[8.4.0.0²,⁷]tetradeca-1(14),10,12-trien-11-yl}-6H-benzo[c]chromene-1-carboxylic acid details
3,4,8,9,10-pentahydroxy-6-oxo-2-[5,6,12,13,14-pentahydroxy-4-(hydroxymethyl)-9-oxo-3,8-dioxatricyclo[8.4.0.0²,⁷]tetradeca-1(14),10,12-trien-11-yl]-6H-benzo[c]chromene-1-carboxylic acid → 3,4,8,9,10-pentahydroxy-6-oxo-2-[6,12,13,14-tetrahydroxy-4-(hydroxymethyl)-9-oxo-5-(sulfooxy)-3,8-dioxatricyclo[8.4.0.0²,⁷]tetradeca-1(14),10,12-trien-11-yl]-6H-benzo[c]chromene-1-carboxylic acid details
3,4,8,9,10-pentahydroxy-6-oxo-2-[5,6,12,13,14-pentahydroxy-4-(hydroxymethyl)-9-oxo-3,8-dioxatricyclo[8.4.0.0²,⁷]tetradeca-1(14),10,12-trien-11-yl]-6H-benzo[c]chromene-1-carboxylic acid → 3,4,8,9,10-pentahydroxy-6-oxo-2-[5,12,13,14-tetrahydroxy-4-(hydroxymethyl)-9-oxo-6-(sulfooxy)-3,8-dioxatricyclo[8.4.0.0²,⁷]tetradeca-1(14),10,12-trien-11-yl]-6H-benzo[c]chromene-1-carboxylic acid details
2-(2,4-dihydroxyphenyl)-7-hydroxy-3-(4-hydroxy-3,7-dimethylocta-2,6-dien-1-yl)-4H-chromen-4-one → ({1-[2-(2,4-dihydroxyphenyl)-7-hydroxy-4-oxo-4H-chromen-3-yl]-3,7-dimethylocta-2,6-dien-4-yl}oxy)sulfonic acid details
2-(2,4-dihydroxyphenyl)-7-hydroxy-3-[(2Z)-4-hydroxy-3-(4-methylpent-3-en-1-yl)but-2-en-1-yl]-4H-chromen-4-one → {[(2Z)-2-{2-[2-(2,4-dihydroxyphenyl)-7-hydroxy-4-oxo-4H-chromen-3-yl]ethylidene}-6-methylhept-5-en-1-yl]oxy}sulfonic acid details
2-(2,4-dihydroxyphenyl)-7-hydroxy-3-(8-hydroxy-3,7-dimethylocta-2,6-dien-1-yl)-4H-chromen-4-one → ({8-[2-(2,4-dihydroxyphenyl)-7-hydroxy-4-oxo-4H-chromen-3-yl]-2,6-dimethylocta-2,6-dien-1-yl}oxy)sulfonic acid details
2-(2,4-dihydroxyphenyl)-7-hydroxy-3-[(6E)-8-hydroxy-3,7-dimethylocta-2,6-dien-1-yl]-4H-chromen-4-one → {[(2E)-8-[2-(2,4-dihydroxyphenyl)-7-hydroxy-4-oxo-4H-chromen-3-yl]-2,6-dimethylocta-2,6-dien-1-yl]oxy}sulfonic acid details
2-(2,4-dihydroxyphenyl)-7-hydroxy-3-(5-hydroxy-3,7-dimethylocta-2,6-dien-1-yl)-4H-chromen-4-one → ({8-[2-(2,4-dihydroxyphenyl)-7-hydroxy-4-oxo-4H-chromen-3-yl]-2,6-dimethylocta-2,6-dien-4-yl}oxy)sulfonic acid details
2-(2,4-dihydroxyphenyl)-3-(3,7-dimethylocta-2,6-dien-1-yl)-7-hydroxy-8-(4-hydroxy-3-methylbut-2-en-1-yl)-4H-chromen-4-one → ({4-[2-(2,4-dihydroxyphenyl)-3-(3,7-dimethylocta-2,6-dien-1-yl)-7-hydroxy-4-oxo-4H-chromen-8-yl]-2-methylbut-2-en-1-yl}oxy)sulfonic acid details
2-(2,4-dihydroxyphenyl)-7-hydroxy-3-(4-hydroxy-3,7-dimethylocta-2,6-dien-1-yl)-8-(3-methylbut-2-en-1-yl)-4H-chromen-4-one → ({1-[2-(2,4-dihydroxyphenyl)-7-hydroxy-8-(3-methylbut-2-en-1-yl)-4-oxo-4H-chromen-3-yl]-3,7-dimethylocta-2,6-dien-4-yl}oxy)sulfonic acid details
2-(2,4-dihydroxyphenyl)-7-hydroxy-3-[4-hydroxy-3-(4-methylpent-3-en-1-yl)but-2-en-1-yl]-8-(3-methylbut-2-en-1-yl)-4H-chromen-4-one → [(2-{2-[2-(2,4-dihydroxyphenyl)-7-hydroxy-8-(3-methylbut-2-en-1-yl)-4-oxo-4H-chromen-3-yl]ethylidene}-6-methylhept-5-en-1-yl)oxy]sulfonic acid details
2-(2,4-dihydroxyphenyl)-7-hydroxy-3-(8-hydroxy-3,7-dimethylocta-2,6-dien-1-yl)-8-(3-methylbut-2-en-1-yl)-4H-chromen-4-one → ({8-[2-(2,4-dihydroxyphenyl)-7-hydroxy-8-(3-methylbut-2-en-1-yl)-4-oxo-4H-chromen-3-yl]-2,6-dimethylocta-2,6-dien-1-yl}oxy)sulfonic acid details
2-(2,4-dihydroxyphenyl)-7-hydroxy-3-[(6E)-8-hydroxy-3,7-dimethylocta-2,6-dien-1-yl]-8-(3-methylbut-2-en-1-yl)-4H-chromen-4-one → {[(2E)-8-[2-(2,4-dihydroxyphenyl)-7-hydroxy-8-(3-methylbut-2-en-1-yl)-4-oxo-4H-chromen-3-yl]-2,6-dimethylocta-2,6-dien-1-yl]oxy}sulfonic acid details
2-(2,4-dihydroxyphenyl)-7-hydroxy-3-(5-hydroxy-3,7-dimethylocta-2,6-dien-1-yl)-8-(3-methylbut-2-en-1-yl)-4H-chromen-4-one → ({8-[2-(2,4-dihydroxyphenyl)-7-hydroxy-8-(3-methylbut-2-en-1-yl)-4-oxo-4H-chromen-3-yl]-2,6-dimethylocta-2,6-dien-4-yl}oxy)sulfonic acid details
2-(2,4-dihydroxyphenyl)-3-(3,7-dimethylocta-2,6-dien-1-yl)-5,7-dihydroxy-6-(4-hydroxy-3-methylbut-2-en-1-yl)-4H-chromen-4-one → ({4-[2-(2,4-dihydroxyphenyl)-3-(3,7-dimethylocta-2,6-dien-1-yl)-5,7-dihydroxy-4-oxo-4H-chromen-6-yl]-2-methylbut-2-en-1-yl}oxy)sulfonic acid details
2-(2,4-dihydroxyphenyl)-5,7-dihydroxy-3-(4-hydroxy-3,7-dimethylocta-2,6-dien-1-yl)-6-(3-methylbut-2-en-1-yl)-4H-chromen-4-one → ({1-[2-(2,4-dihydroxyphenyl)-5,7-dihydroxy-6-(3-methylbut-2-en-1-yl)-4-oxo-4H-chromen-3-yl]-3,7-dimethylocta-2,6-dien-4-yl}oxy)sulfonic acid details
2-(2,4-dihydroxyphenyl)-5,7-dihydroxy-3-[4-hydroxy-3-(4-methylpent-3-en-1-yl)but-2-en-1-yl]-6-(3-methylbut-2-en-1-yl)-4H-chromen-4-one → [(2-{2-[2-(2,4-dihydroxyphenyl)-5,7-dihydroxy-6-(3-methylbut-2-en-1-yl)-4-oxo-4H-chromen-3-yl]ethylidene}-6-methylhept-5-en-1-yl)oxy]sulfonic acid details
2-(2,4-dihydroxyphenyl)-5,7-dihydroxy-3-(8-hydroxy-3,7-dimethylocta-2,6-dien-1-yl)-6-(3-methylbut-2-en-1-yl)-4H-chromen-4-one → ({8-[2-(2,4-dihydroxyphenyl)-5,7-dihydroxy-6-(3-methylbut-2-en-1-yl)-4-oxo-4H-chromen-3-yl]-2,6-dimethylocta-2,6-dien-1-yl}oxy)sulfonic acid details
2-(2,4-dihydroxyphenyl)-5,7-dihydroxy-3-[(6E)-8-hydroxy-3,7-dimethylocta-2,6-dien-1-yl]-6-(3-methylbut-2-en-1-yl)-4H-chromen-4-one → {[(2E)-8-[2-(2,4-dihydroxyphenyl)-5,7-dihydroxy-6-(3-methylbut-2-en-1-yl)-4-oxo-4H-chromen-3-yl]-2,6-dimethylocta-2,6-dien-1-yl]oxy}sulfonic acid details
2-(2,4-dihydroxyphenyl)-5,7-dihydroxy-3-(5-hydroxy-3,7-dimethylocta-2,6-dien-1-yl)-6-(3-methylbut-2-en-1-yl)-4H-chromen-4-one → ({8-[2-(2,4-dihydroxyphenyl)-5,7-dihydroxy-6-(3-methylbut-2-en-1-yl)-4-oxo-4H-chromen-3-yl]-2,6-dimethylocta-2,6-dien-4-yl}oxy)sulfonic acid details
2-(2,4-dihydroxyphenyl)-3-(3,7-dimethylocta-2,6-dien-1-yl)-5,7-dihydroxy-6-(4-hydroxy-3-methylbut-2-en-1-yl)-3,4-dihydro-2H-1-benzopyran-4-one → ({4-[2-(2,4-dihydroxyphenyl)-3-(3,7-dimethylocta-2,6-dien-1-yl)-5,7-dihydroxy-4-oxo-3,4-dihydro-2H-1-benzopyran-6-yl]-2-methylbut-2-en-1-yl}oxy)sulfonic acid details
2-(2,4-dihydroxyphenyl)-5,7-dihydroxy-3-(4-hydroxy-3,7-dimethylocta-2,6-dien-1-yl)-6-(3-methylbut-2-en-1-yl)-3,4-dihydro-2H-1-benzopyran-4-one → ({1-[2-(2,4-dihydroxyphenyl)-5,7-dihydroxy-6-(3-methylbut-2-en-1-yl)-4-oxo-3,4-dihydro-2H-1-benzopyran-3-yl]-3,7-dimethylocta-2,6-dien-4-yl}oxy)sulfonic acid details
2-(2,4-dihydroxyphenyl)-5,7-dihydroxy-3-[4-hydroxy-3-(4-methylpent-3-en-1-yl)but-2-en-1-yl]-6-(3-methylbut-2-en-1-yl)-3,4-dihydro-2H-1-benzopyran-4-one → [(2-{2-[2-(2,4-dihydroxyphenyl)-5,7-dihydroxy-6-(3-methylbut-2-en-1-yl)-4-oxo-3,4-dihydro-2H-1-benzopyran-3-yl]ethylidene}-6-methylhept-5-en-1-yl)oxy]sulfonic acid details
2-(2,4-dihydroxyphenyl)-5,7-dihydroxy-3-(8-hydroxy-3,7-dimethylocta-2,6-dien-1-yl)-6-(3-methylbut-2-en-1-yl)-3,4-dihydro-2H-1-benzopyran-4-one → ({8-[2-(2,4-dihydroxyphenyl)-5,7-dihydroxy-6-(3-methylbut-2-en-1-yl)-4-oxo-3,4-dihydro-2H-1-benzopyran-3-yl]-2,6-dimethylocta-2,6-dien-1-yl}oxy)sulfonic acid details
2-(2,4-dihydroxyphenyl)-5,7-dihydroxy-3-[(6E)-8-hydroxy-3,7-dimethylocta-2,6-dien-1-yl]-6-(3-methylbut-2-en-1-yl)-3,4-dihydro-2H-1-benzopyran-4-one → {[(2E)-8-[2-(2,4-dihydroxyphenyl)-5,7-dihydroxy-6-(3-methylbut-2-en-1-yl)-4-oxo-3,4-dihydro-2H-1-benzopyran-3-yl]-2,6-dimethylocta-2,6-dien-1-yl]oxy}sulfonic acid details
2-(2,4-dihydroxyphenyl)-5,7-dihydroxy-3-(5-hydroxy-3,7-dimethylocta-2,6-dien-1-yl)-6-(3-methylbut-2-en-1-yl)-3,4-dihydro-2H-1-benzopyran-4-one → ({8-[2-(2,4-dihydroxyphenyl)-5,7-dihydroxy-6-(3-methylbut-2-en-1-yl)-4-oxo-3,4-dihydro-2H-1-benzopyran-3-yl]-2,6-dimethylocta-2,6-dien-4-yl}oxy)sulfonic acid details
2-(2,4-dihydroxyphenyl)-3-(3,7-dimethylocta-2,6-dien-1-yl)-5-hydroxy-8-(hydroxymethyl)-8-methyl-4H,8H-pyrano[3,2-g]chromen-4-one → {[8-(2,4-dihydroxyphenyl)-7-(3,7-dimethylocta-2,6-dien-1-yl)-5-hydroxy-2-methyl-6-oxo-2H,6H-pyrano[3,2-g]chromen-2-yl]methoxy}sulfonic acid details
Castanin → (10-{2,3,4,7,8,9,19-heptahydroxy-12,17-dioxo-13,16-dioxatetracyclo[13.3.1.0⁵,¹⁸.0⁶,¹¹]nonadeca-1,3,5(18),6,8,10-hexaen-14-yl}-3,4,5,16,17,18-hexahydroxy-8,14-dioxo-9,13-dioxatricyclo[13.3.1.0²,⁷]nonadeca-1(19),2,4,6,15,17-hexaen-11-yl)oxidanesulfonic acid details
Castanin → (14-{3,4,5,11,16,17,18-heptahydroxy-8,14-dioxo-9,13-dioxatricyclo[13.3.1.0²,⁷]nonadeca-1(19),2,4,6,15,17-hexaen-10-yl}-2,3,4,7,8,9-hexahydroxy-12,17-dioxo-13,16-dioxatetracyclo[13.3.1.0⁵,¹⁸.0⁶,¹¹]nonadeca-1,3,5(18),6,8,10-hexaen-19-yl)oxidanesulfonic acid details
Castacrenin C → [2,3,4-trihydroxy-4-(5,6,7-trihydroxy-1-oxo-8-{6,7,13,14-tetrahydroxy-3,10-dioxo-2,9-dioxatetracyclo[6.6.2.0⁴,¹⁶.0¹¹,¹⁵]hexadeca-1(15),4,6,8(16),11,13-hexaen-5-yl}-1H-isochromen-3-yl)butoxy]sulfonic acid details
Castacrenin C → [2,3,4-trihydroxy-1-(5,6,7-trihydroxy-1-oxo-8-{6,7,13,14-tetrahydroxy-3,10-dioxo-2,9-dioxatetracyclo[6.6.2.0⁴,¹⁶.0¹¹,¹⁵]hexadeca-1(15),4,6,8(16),11,13-hexaen-5-yl}-1H-isochromen-3-yl)butoxy]sulfonic acid details
Castacrenin C → {[1,3,4-trihydroxy-1-(5,6,7-trihydroxy-1-oxo-8-{6,7,13,14-tetrahydroxy-3,10-dioxo-2,9-dioxatetracyclo[6.6.2.0⁴,¹⁶.0¹¹,¹⁵]hexadeca-1(15),4,6,8(16),11,13-hexaen-5-yl}-1H-isochromen-3-yl)butan-2-yl]oxy}sulfonic acid details
Castacrenin C → {[1,3,4-trihydroxy-4-(5,6,7-trihydroxy-1-oxo-8-{6,7,13,14-tetrahydroxy-3,10-dioxo-2,9-dioxatetracyclo[6.6.2.0⁴,¹⁶.0¹¹,¹⁵]hexadeca-1(15),4,6,8(16),11,13-hexaen-5-yl}-1H-isochromen-3-yl)butan-2-yl]oxy}sulfonic acid details
3,4,8,9,10-pentahydroxy-6-oxo-2-[5,6,7-trihydroxy-1-oxo-3-(1,2,3,4-tetrahydroxybutyl)-1H-isochromen-8-yl]-6H-benzo[c]chromene-1-carboxylic acid → 3,4,8,9,10-pentahydroxy-6-oxo-2-{5,6,7-trihydroxy-1-oxo-3-[1,2,3-trihydroxy-4-(sulfooxy)butyl]-1H-isochromen-8-yl}-6H-benzo[c]chromene-1-carboxylic acid details
3,4,8,9,10-pentahydroxy-6-oxo-2-[5,6,7-trihydroxy-1-oxo-3-(1,2,3,4-tetrahydroxybutyl)-1H-isochromen-8-yl]-6H-benzo[c]chromene-1-carboxylic acid → 3,4,8,9,10-pentahydroxy-6-oxo-2-{5,6,7-trihydroxy-1-oxo-3-[2,3,4-trihydroxy-1-(sulfooxy)butyl]-1H-isochromen-8-yl}-6H-benzo[c]chromene-1-carboxylic acid details
3,4,8,9,10-pentahydroxy-6-oxo-2-[5,6,7-trihydroxy-1-oxo-3-(1,2,3,4-tetrahydroxybutyl)-1H-isochromen-8-yl]-6H-benzo[c]chromene-1-carboxylic acid → 3,4,8,9,10-pentahydroxy-6-oxo-2-{5,6,7-trihydroxy-1-oxo-3-[1,3,4-trihydroxy-2-(sulfooxy)butyl]-1H-isochromen-8-yl}-6H-benzo[c]chromene-1-carboxylic acid details
3,4,8,9,10-pentahydroxy-6-oxo-2-[5,6,7-trihydroxy-1-oxo-3-(1,2,3,4-tetrahydroxybutyl)-1H-isochromen-8-yl]-6H-benzo[c]chromene-1-carboxylic acid → 3,4,8,9,10-pentahydroxy-6-oxo-2-{5,6,7-trihydroxy-1-oxo-3-[1,2,4-trihydroxy-3-(sulfooxy)butyl]-1H-isochromen-8-yl}-6H-benzo[c]chromene-1-carboxylic acid details
3-[(1E)-3-hydroxybut-1-en-1-yl]-1H-isochromen-1-one → {[(3E)-4-(1-oxo-1H-isochromen-3-yl)but-3-en-2-yl]oxy}sulfonic acid details
3-[(1E)-4-hydroxybut-1-en-1-yl]-1H-isochromen-1-one → {[(3E)-4-(1-oxo-1H-isochromen-3-yl)but-3-en-1-yl]oxy}sulfonic acid details
5-hydroxy-3-[(1E)-3-hydroxybut-1-en-1-yl]-1H-isochromen-1-one → {[(3E)-4-(5-hydroxy-1-oxo-1H-isochromen-3-yl)but-3-en-2-yl]oxy}sulfonic acid details
5-hydroxy-3-[(1E)-4-hydroxybut-1-en-1-yl]-1H-isochromen-1-one → {[(3E)-4-(5-hydroxy-1-oxo-1H-isochromen-3-yl)but-3-en-1-yl]oxy}sulfonic acid details
Artemidiol → [2-hydroxy-1-(1-oxo-1H-isochromen-3-yl)butoxy]sulfonic acid details
Artemidiol → {[1-hydroxy-1-(1-oxo-1H-isochromen-3-yl)butan-2-yl]oxy}sulfonic acid details
3-(1,2-dihydroxybutyl)-7-hydroxy-1H-isochromen-1-one → [2-hydroxy-1-(7-hydroxy-1-oxo-1H-isochromen-3-yl)butoxy]sulfonic acid details
3-(1,2-dihydroxybutyl)-7-hydroxy-1H-isochromen-1-one → {[1-hydroxy-1-(7-hydroxy-1-oxo-1H-isochromen-3-yl)butan-2-yl]oxy}sulfonic acid details
3-(1,2-dihydroxybutyl)-6-hydroxy-1H-isochromen-1-one → [2-hydroxy-1-(6-hydroxy-1-oxo-1H-isochromen-3-yl)butoxy]sulfonic acid details
3-(1,2-dihydroxybutyl)-6-hydroxy-1H-isochromen-1-one → {[1-hydroxy-1-(6-hydroxy-1-oxo-1H-isochromen-3-yl)butan-2-yl]oxy}sulfonic acid details
3-(1,2,3-trihydroxybutyl)-1H-isochromen-1-one → {[3,4-dihydroxy-4-(1-oxo-1H-isochromen-3-yl)butan-2-yl]oxy}sulfonic acid details
3-(1,2,3-trihydroxybutyl)-1H-isochromen-1-one → [2,3-dihydroxy-1-(1-oxo-1H-isochromen-3-yl)butoxy]sulfonic acid details
3-(1,2,3-trihydroxybutyl)-1H-isochromen-1-one → {[1,3-dihydroxy-1-(1-oxo-1H-isochromen-3-yl)butan-2-yl]oxy}sulfonic acid details
3-(1,2-dihydroxybutyl)-5-hydroxy-1H-isochromen-1-one → [2-hydroxy-1-(5-hydroxy-1-oxo-1H-isochromen-3-yl)butoxy]sulfonic acid details
3-(1,2-dihydroxybutyl)-5-hydroxy-1H-isochromen-1-one → {[1-hydroxy-1-(5-hydroxy-1-oxo-1H-isochromen-3-yl)butan-2-yl]oxy}sulfonic acid details
3-(1,2,4-trihydroxybutyl)-1H-isochromen-1-one → [3,4-dihydroxy-4-(1-oxo-1H-isochromen-3-yl)butoxy]sulfonic acid details
3-(1,2,4-trihydroxybutyl)-1H-isochromen-1-one → [2,4-dihydroxy-1-(1-oxo-1H-isochromen-3-yl)butoxy]sulfonic acid details
3-(1,2,4-trihydroxybutyl)-1H-isochromen-1-one → {[1,4-dihydroxy-1-(1-oxo-1H-isochromen-3-yl)butan-2-yl]oxy}sulfonic acid details
3-(1,2-dihydroxybut-3-en-1-yl)-1H-isochromen-1-one → {[2-hydroxy-1-(1-oxo-1H-isochromen-3-yl)but-3-en-1-yl]oxy}sulfonic acid details
3-(1,2-dihydroxybut-3-en-1-yl)-1H-isochromen-1-one → {[1-hydroxy-1-(1-oxo-1H-isochromen-3-yl)but-3-en-2-yl]oxy}sulfonic acid details
Mammea B/BC cyclo E → {10-butanoyl-5-hydroxy-2,2-dimethyl-8-oxo-6-propyl-2H,3H,4H,8H-pyrano[3,2-g]chromen-3-yl}oxidanesulfonic acid details
10-butanoyl-5,7-dihydroxy-4-(2-hydroxypropyl)-8,8-dimethyl-2H,6H,7H,8H-pyrano[3,2-g]chromen-2-one → [(1-{10-butanoyl-5,7-dihydroxy-8,8-dimethyl-2-oxo-2H,6H,7H,8H-pyrano[3,2-g]chromen-4-yl}propan-2-yl)oxy]sulfonic acid details
10-butanoyl-5,7-dihydroxy-4-(2-hydroxypropyl)-8,8-dimethyl-2H,6H,7H,8H-pyrano[3,2-g]chromen-2-one → [10-butanoyl-5-hydroxy-6-(2-hydroxypropyl)-2,2-dimethyl-8-oxo-2H,3H,4H,8H-pyrano[3,2-g]chromen-3-yl]oxidanesulfonic acid details
5,7-dihydroxy-10-(3-hydroxybutanoyl)-8,8-dimethyl-4-propyl-2H,6H,7H,8H-pyrano[3,2-g]chromen-2-one → [(4-{3,5-dihydroxy-2,2-dimethyl-8-oxo-6-propyl-2H,3H,4H,8H-pyrano[3,2-g]chromen-10-yl}-4-oxobutan-2-yl)oxy]sulfonic acid details
5,7-dihydroxy-10-(3-hydroxybutanoyl)-8,8-dimethyl-4-propyl-2H,6H,7H,8H-pyrano[3,2-g]chromen-2-one → [5-hydroxy-10-(3-hydroxybutanoyl)-2,2-dimethyl-8-oxo-6-propyl-2H,3H,4H,8H-pyrano[3,2-g]chromen-3-yl]oxidanesulfonic acid details
10-butanoyl-5,7-dihydroxy-4-(3-hydroxypropyl)-8,8-dimethyl-2H,6H,7H,8H-pyrano[3,2-g]chromen-2-one → (3-{10-butanoyl-5,7-dihydroxy-8,8-dimethyl-2-oxo-2H,6H,7H,8H-pyrano[3,2-g]chromen-4-yl}propoxy)sulfonic acid details
10-butanoyl-5,7-dihydroxy-4-(3-hydroxypropyl)-8,8-dimethyl-2H,6H,7H,8H-pyrano[3,2-g]chromen-2-one → [10-butanoyl-5-hydroxy-6-(3-hydroxypropyl)-2,2-dimethyl-8-oxo-2H,3H,4H,8H-pyrano[3,2-g]chromen-3-yl]oxidanesulfonic acid details
5,7-dihydroxy-10-(4-hydroxybutanoyl)-8,8-dimethyl-4-propyl-2H,6H,7H,8H-pyrano[3,2-g]chromen-2-one → (4-{3,5-dihydroxy-2,2-dimethyl-8-oxo-6-propyl-2H,3H,4H,8H-pyrano[3,2-g]chromen-10-yl}-4-oxobutoxy)sulfonic acid details
5,7-dihydroxy-10-(4-hydroxybutanoyl)-8,8-dimethyl-4-propyl-2H,6H,7H,8H-pyrano[3,2-g]chromen-2-one → [5-hydroxy-10-(4-hydroxybutanoyl)-2,2-dimethyl-8-oxo-6-propyl-2H,3H,4H,8H-pyrano[3,2-g]chromen-3-yl]oxidanesulfonic acid details
10-butanoyl-5,7-dihydroxy-8,8-dimethyl-4-(prop-2-en-1-yl)-2H,6H,7H,8H-pyrano[3,2-g]chromen-2-one → [10-butanoyl-5-hydroxy-2,2-dimethyl-8-oxo-6-(prop-2-en-1-yl)-2H,3H,4H,8H-pyrano[3,2-g]chromen-3-yl]oxidanesulfonic acid details
10-(but-3-enoyl)-5,7-dihydroxy-8,8-dimethyl-4-propyl-2H,6H,7H,8H-pyrano[3,2-g]chromen-2-one → [10-(but-3-enoyl)-5-hydroxy-2,2-dimethyl-8-oxo-6-propyl-2H,3H,4H,8H-pyrano[3,2-g]chromen-3-yl]oxidanesulfonic acid details
3-Hydroxybutyric acid → 3-(sulfooxy)butanoic acid details
4-Hydroxybutyric acid → 4-(sulfooxy)butanoic acid details
2-Hydroxybutyric acid → 2-(sulfooxy)butanoic acid details
5-hydroxy-8-(2-hydroxypropan-2-yl)-4-(1-hydroxypropyl)-2H,8H,9H-furo[2,3-h]chromen-2-one → {1-[5-hydroxy-8-(2-hydroxypropan-2-yl)-2-oxo-2H,8H,9H-furo[2,3-h]chromen-4-yl]propoxy}sulfonic acid details
5-hydroxy-8-(2-hydroxypropan-2-yl)-4-(2-hydroxypropyl)-2H,8H,9H-furo[2,3-h]chromen-2-one → ({1-[5-hydroxy-8-(2-hydroxypropan-2-yl)-2-oxo-2H,8H,9H-furo[2,3-h]chromen-4-yl]propan-2-yl}oxy)sulfonic acid details
8-(1,2-dihydroxypropan-2-yl)-5-hydroxy-4-propyl-2H,8H,9H-furo[2,3-h]chromen-2-one → (2-hydroxy-2-{5-hydroxy-2-oxo-4-propyl-2H,8H,9H-furo[2,3-h]chromen-8-yl}propoxy)sulfonic acid details
5-hydroxy-8-(2-hydroxypropan-2-yl)-4-(3-hydroxypropyl)-2H,8H,9H-furo[2,3-h]chromen-2-one → {3-[5-hydroxy-8-(2-hydroxypropan-2-yl)-2-oxo-2H,8H,9H-furo[2,3-h]chromen-4-yl]propoxy}sulfonic acid details
Mukurozidiol → {[3-hydroxy-1-({4-methoxy-7-oxo-7H-furo[3,2-g]chromen-9-yl}oxy)-3-methylbutan-2-yl]oxy}sulfonic acid details
3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid → 3,4-dihydroxy-5-(sulfooxy)cyclohex-1-ene-1-carboxylic acid details
3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid → 3,5-dihydroxy-4-(sulfooxy)cyclohex-1-ene-1-carboxylic acid details
3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid → 4,5-dihydroxy-3-(sulfooxy)cyclohex-1-ene-1-carboxylic acid details
2-[2-hydroxy-3-(3-hydroxy-4-methoxyphenyl)propyl]benzene-1,3,5-triol → {[1-(3-hydroxy-4-methoxyphenyl)-3-(2,4,6-trihydroxyphenyl)propan-2-yl]oxy}sulfonic acid details
4-hydroxy-5-(3-hydroxy-4-methoxyphenyl)pentanoic acid → 5-(3-hydroxy-4-methoxyphenyl)-4-(sulfooxy)pentanoic acid details
3-Hydroxy-4-methoxyphenyllactic acid → 3-(3-hydroxy-4-methoxyphenyl)-2-(sulfooxy)propanoic acid details
2-[6-(1-hydroxy-2-methylbut-3-en-2-yl)-7-oxo-2H,3H,7H-furo[3,2-g]chromen-2-yl]propan-2-yl acetate → [(2-{2-[2-(acetyloxy)propan-2-yl]-7-oxo-2H,3H,7H-furo[3,2-g]chromen-6-yl}-2-methylbut-3-en-1-yl)oxy]sulfonic acid details
1-hydroxy-2-[6-(2-methylbut-3-en-2-yl)-7-oxo-2H,3H,7H-furo[3,2-g]chromen-2-yl]propan-2-yl acetate → [2-(acetyloxy)-2-[6-(2-methylbut-3-en-2-yl)-7-oxo-2H,3H,7H-furo[3,2-g]chromen-2-yl]propoxy]sulfonic acid details
2-[6-(2-methylbut-3-en-2-yl)-7-oxo-2H,3H,7H-furo[3,2-g]chromen-2-yl]propan-2-yl 2-hydroxyacetate → [2-({2-[6-(2-methylbut-3-en-2-yl)-7-oxo-2H,3H,7H-furo[3,2-g]chromen-2-yl]propan-2-yl}oxy)-2-oxoethoxy]sulfonic acid details
2-[3-hydroxy-6-(2-methylbut-3-en-2-yl)-7-oxo-2H,3H,7H-furo[3,2-g]chromen-2-yl]propan-2-yl acetate → {2-[2-(acetyloxy)propan-2-yl]-6-(2-methylbut-3-en-2-yl)-7-oxo-2H,3H,7H-furo[3,2-g]chromen-3-yl}oxidanesulfonic acid details
6-(1-hydroxy-2-methylbut-3-en-2-yl)-2-(2-hydroxypropan-2-yl)-2H,3H,7H-furo[3,2-g]chromen-7-one → ({2-[2-(2-hydroxypropan-2-yl)-7-oxo-2H,3H,7H-furo[3,2-g]chromen-6-yl]-2-methylbut-3-en-1-yl}oxy)sulfonic acid details
2-(1,2-dihydroxypropan-2-yl)-6-(2-methylbut-3-en-2-yl)-2H,3H,7H-furo[3,2-g]chromen-7-one → {2-hydroxy-2-[6-(2-methylbut-3-en-2-yl)-7-oxo-2H,3H,7H-furo[3,2-g]chromen-2-yl]propoxy}sulfonic acid details
3-hydroxy-2-(2-hydroxypropan-2-yl)-6-(2-methylbut-3-en-2-yl)-2H,3H,7H-furo[3,2-g]chromen-7-one → [2-(2-hydroxypropan-2-yl)-6-(2-methylbut-3-en-2-yl)-7-oxo-2H,3H,7H-furo[3,2-g]chromen-3-yl]oxidanesulfonic acid details
6-(3,4-dihydroxy-3-methylbut-1-en-1-yl)-7-methoxy-2H-chromen-2-one → {[2-hydroxy-4-(7-methoxy-2-oxo-2H-chromen-6-yl)-2-methylbut-3-en-1-yl]oxy}sulfonic acid details
6-(1,3-dihydroxy-3-methylbutyl)-7-methoxy-2H-chromen-2-one → [3-hydroxy-1-(7-methoxy-2-oxo-2H-chromen-6-yl)-3-methylbutoxy]sulfonic acid details
6-(3,4-dihydroxy-3-methylbutyl)-7-methoxy-2H-chromen-2-one → [2-hydroxy-4-(7-methoxy-2-oxo-2H-chromen-6-yl)-2-methylbutoxy]sulfonic acid details
5,7-dihydroxy-8-(hydroxymethyl)-6-methyl-2-phenyl-3,4-dihydro-2H-1-benzopyran-4-one → [(5,7-dihydroxy-6-methyl-4-oxo-2-phenyl-3,4-dihydro-2H-1-benzopyran-8-yl)methoxy]sulfonic acid details
5,7-dihydroxy-6-(hydroxymethyl)-8-methyl-2-phenyl-3,4-dihydro-2H-1-benzopyran-4-one → [(5,7-dihydroxy-8-methyl-4-oxo-2-phenyl-3,4-dihydro-2H-1-benzopyran-6-yl)methoxy]sulfonic acid details
6,8-dimethyl-2-phenyl-3,4-dihydro-2H-1-benzopyran-4,5,7-triol → (5,7-dihydroxy-6,8-dimethyl-2-phenyl-3,4-dihydro-2H-1-benzopyran-4-yl)oxidanesulfonic acid details
3-phenyl-1-[2,4,6-trihydroxy-3-(hydroxymethyl)-5-methylphenyl]prop-2-en-1-one → {[2,4,6-trihydroxy-3-methyl-5-(3-phenylprop-2-enoyl)phenyl]methoxy}sulfonic acid details
3-phenyl-1-[2,4,6-trihydroxy-3-(hydroxymethyl)-5-methylphenyl]propan-1-one → {[2,4,6-trihydroxy-3-methyl-5-(3-phenylpropanoyl)phenyl]methoxy}sulfonic acid details
7-hydroxy-6-(hydroxymethyl)-5-methoxy-8-methyl-2-phenyl-3,4-dihydro-2H-1-benzopyran-4-one → [(7-hydroxy-5-methoxy-8-methyl-4-oxo-2-phenyl-3,4-dihydro-2H-1-benzopyran-6-yl)methoxy]sulfonic acid details
7-hydroxy-8-(hydroxymethyl)-5-methoxy-6-methyl-2-phenyl-3,4-dihydro-2H-1-benzopyran-4-one → [(7-hydroxy-5-methoxy-6-methyl-4-oxo-2-phenyl-3,4-dihydro-2H-1-benzopyran-8-yl)methoxy]sulfonic acid details
5-methoxy-6,8-dimethyl-2-phenyl-3,4-dihydro-2H-1-benzopyran-4,7-diol → (7-hydroxy-5-methoxy-6,8-dimethyl-2-phenyl-3,4-dihydro-2H-1-benzopyran-4-yl)oxidanesulfonic acid details
Vicenin 2 → ({6-[5,7-dihydroxy-2-(4-hydroxyphenyl)-4-oxo-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-8-yl]-3,4,5-trihydroxyoxan-2-yl}methoxy)sulfonic acid details
Vicenin 2 → ({6-[5,7-dihydroxy-2-(4-hydroxyphenyl)-4-oxo-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-6-yl]-3,4,5-trihydroxyoxan-2-yl}methoxy)sulfonic acid details
Vicenin 2 → {2-[5,7-dihydroxy-2-(4-hydroxyphenyl)-4-oxo-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-8-yl]-4,5-dihydroxy-6-(hydroxymethyl)oxan-3-yl}oxidanesulfonic acid details
Vicenin 2 → {2-[5,7-dihydroxy-2-(4-hydroxyphenyl)-4-oxo-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-8-yl]-3,5-dihydroxy-6-(hydroxymethyl)oxan-4-yl}oxidanesulfonic acid details
Vicenin 2 → {6-[5,7-dihydroxy-2-(4-hydroxyphenyl)-4-oxo-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-8-yl]-4,5-dihydroxy-2-(hydroxymethyl)oxan-3-yl}oxidanesulfonic acid details
Vicenin 2 → {6-[5,7-dihydroxy-2-(4-hydroxyphenyl)-4-oxo-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-6-yl]-4,5-dihydroxy-2-(hydroxymethyl)oxan-3-yl}oxidanesulfonic acid details
Vicenin 2 → {2-[5,7-dihydroxy-2-(4-hydroxyphenyl)-4-oxo-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-6-yl]-3,5-dihydroxy-6-(hydroxymethyl)oxan-4-yl}oxidanesulfonic acid details
Vicenin 2 → {2-[5,7-dihydroxy-2-(4-hydroxyphenyl)-4-oxo-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-6-yl]-4,5-dihydroxy-6-(hydroxymethyl)oxan-3-yl}oxidanesulfonic acid details
2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-6,8-bis[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → ({6-[2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-4-oxo-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-8-yl]-3,4,5-trihydroxyoxan-2-yl}methoxy)sulfonic acid details
2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-6,8-bis[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → ({6-[2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-4-oxo-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-6-yl]-3,4,5-trihydroxyoxan-2-yl}methoxy)sulfonic acid details
2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-6,8-bis[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → {2-[2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-4-oxo-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-8-yl]-4,5-dihydroxy-6-(hydroxymethyl)oxan-3-yl}oxidanesulfonic acid details
2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-6,8-bis[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → {2-[2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-4-oxo-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-8-yl]-3,5-dihydroxy-6-(hydroxymethyl)oxan-4-yl}oxidanesulfonic acid details
2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-6,8-bis[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → {6-[2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-4-oxo-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-8-yl]-4,5-dihydroxy-2-(hydroxymethyl)oxan-3-yl}oxidanesulfonic acid details
2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-6,8-bis[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → {6-[2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-4-oxo-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-6-yl]-4,5-dihydroxy-2-(hydroxymethyl)oxan-3-yl}oxidanesulfonic acid details
2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-6,8-bis[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → {2-[2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-4-oxo-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-6-yl]-3,5-dihydroxy-6-(hydroxymethyl)oxan-4-yl}oxidanesulfonic acid details
2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-6,8-bis[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → {2-[2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-4-oxo-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-6-yl]-4,5-dihydroxy-6-(hydroxymethyl)oxan-3-yl}oxidanesulfonic acid details
5,7-dihydroxy-2-phenyl-6,8-bis[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → [(6-{5,7-dihydroxy-4-oxo-2-phenyl-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-8-yl}-3,4,5-trihydroxyoxan-2-yl)methoxy]sulfonic acid details
5,7-dihydroxy-2-phenyl-6,8-bis[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → [(6-{5,7-dihydroxy-4-oxo-2-phenyl-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-6-yl}-3,4,5-trihydroxyoxan-2-yl)methoxy]sulfonic acid details
5,7-dihydroxy-2-phenyl-6,8-bis[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → (2-{5,7-dihydroxy-4-oxo-2-phenyl-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-8-yl}-4,5-dihydroxy-6-(hydroxymethyl)oxan-3-yl)oxidanesulfonic acid details
5,7-dihydroxy-2-phenyl-6,8-bis[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → (2-{5,7-dihydroxy-4-oxo-2-phenyl-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-8-yl}-3,5-dihydroxy-6-(hydroxymethyl)oxan-4-yl)oxidanesulfonic acid details
5,7-dihydroxy-2-phenyl-6,8-bis[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → (6-{5,7-dihydroxy-4-oxo-2-phenyl-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-8-yl}-4,5-dihydroxy-2-(hydroxymethyl)oxan-3-yl)oxidanesulfonic acid details
5,7-dihydroxy-2-phenyl-6,8-bis[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → (6-{5,7-dihydroxy-4-oxo-2-phenyl-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-6-yl}-4,5-dihydroxy-2-(hydroxymethyl)oxan-3-yl)oxidanesulfonic acid details
5,7-dihydroxy-2-phenyl-6,8-bis[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → (2-{5,7-dihydroxy-4-oxo-2-phenyl-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-6-yl}-3,5-dihydroxy-6-(hydroxymethyl)oxan-4-yl)oxidanesulfonic acid details
5,7-dihydroxy-2-phenyl-6,8-bis[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → (2-{5,7-dihydroxy-4-oxo-2-phenyl-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-6-yl}-4,5-dihydroxy-6-(hydroxymethyl)oxan-3-yl)oxidanesulfonic acid details
5,7-dihydroxy-2-(3-hydroxyphenyl)-6,8-bis[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → ({6-[5,7-dihydroxy-2-(3-hydroxyphenyl)-4-oxo-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-8-yl]-3,4,5-trihydroxyoxan-2-yl}methoxy)sulfonic acid details
5,7-dihydroxy-2-(3-hydroxyphenyl)-6,8-bis[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → ({6-[5,7-dihydroxy-2-(3-hydroxyphenyl)-4-oxo-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-6-yl]-3,4,5-trihydroxyoxan-2-yl}methoxy)sulfonic acid details
5,7-dihydroxy-2-(3-hydroxyphenyl)-6,8-bis[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → {2-[5,7-dihydroxy-2-(3-hydroxyphenyl)-4-oxo-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-8-yl]-4,5-dihydroxy-6-(hydroxymethyl)oxan-3-yl}oxidanesulfonic acid details
5,7-dihydroxy-2-(3-hydroxyphenyl)-6,8-bis[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → {2-[5,7-dihydroxy-2-(3-hydroxyphenyl)-4-oxo-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-8-yl]-3,5-dihydroxy-6-(hydroxymethyl)oxan-4-yl}oxidanesulfonic acid details
5,7-dihydroxy-2-(3-hydroxyphenyl)-6,8-bis[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → {6-[5,7-dihydroxy-2-(3-hydroxyphenyl)-4-oxo-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-8-yl]-4,5-dihydroxy-2-(hydroxymethyl)oxan-3-yl}oxidanesulfonic acid details
5,7-dihydroxy-2-(3-hydroxyphenyl)-6,8-bis[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → {6-[5,7-dihydroxy-2-(3-hydroxyphenyl)-4-oxo-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-6-yl]-4,5-dihydroxy-2-(hydroxymethyl)oxan-3-yl}oxidanesulfonic acid details
5,7-dihydroxy-2-(3-hydroxyphenyl)-6,8-bis[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → {2-[5,7-dihydroxy-2-(3-hydroxyphenyl)-4-oxo-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-6-yl]-3,5-dihydroxy-6-(hydroxymethyl)oxan-4-yl}oxidanesulfonic acid details
5,7-dihydroxy-2-(3-hydroxyphenyl)-6,8-bis[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → {2-[5,7-dihydroxy-2-(3-hydroxyphenyl)-4-oxo-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-6-yl]-4,5-dihydroxy-6-(hydroxymethyl)oxan-3-yl}oxidanesulfonic acid details
4-Hydroxyisovaleric acid → 3-methyl-4-(sulfooxy)butanoic acid details
2-Hydroxy-3-methylbutyric acid → 3-methyl-2-(sulfooxy)butanoic acid details
8-(1,2-dihydroxypropan-2-yl)-5-hydroxy-4-phenyl-2H,8H,9H-furo[2,3-h]chromen-2-one → (2-hydroxy-2-{5-hydroxy-2-oxo-4-phenyl-2H,8H,9H-furo[2,3-h]chromen-8-yl}propoxy)sulfonic acid details
4-hydroxy-2-(2-hydroxypropan-2-yl)-9-(1-hydroxypropyl)-2H,3H,7H-furo[2,3-f]chromen-7-one → {1-[4-hydroxy-2-(2-hydroxypropan-2-yl)-7-oxo-2H,3H,7H-furo[2,3-f]chromen-9-yl]propoxy}sulfonic acid details
4-hydroxy-2-(2-hydroxypropan-2-yl)-9-(2-hydroxypropyl)-2H,3H,7H-furo[2,3-f]chromen-7-one → ({1-[4-hydroxy-2-(2-hydroxypropan-2-yl)-7-oxo-2H,3H,7H-furo[2,3-f]chromen-9-yl]propan-2-yl}oxy)sulfonic acid details
2-(1,2-dihydroxypropan-2-yl)-4-hydroxy-9-propyl-2H,3H,7H-furo[2,3-f]chromen-7-one → (2-hydroxy-2-{4-hydroxy-7-oxo-9-propyl-2H,3H,7H-furo[2,3-f]chromen-2-yl}propoxy)sulfonic acid details
4-hydroxy-2-(2-hydroxypropan-2-yl)-9-(3-hydroxypropyl)-2H,3H,7H-furo[2,3-f]chromen-7-one → {3-[4-hydroxy-2-(2-hydroxypropan-2-yl)-7-oxo-2H,3H,7H-furo[2,3-f]chromen-9-yl]propoxy}sulfonic acid details
2-Methyl-3-hydroxybutyric acid → 2-methyl-3-(sulfooxy)butanoic acid details
2-Ethylhydracrylic acid → 2-[(sulfooxy)methyl]butanoic acid details
4-hydroxy-2-methylbutanoic acid → 2-methyl-4-(sulfooxy)butanoic acid details
3-[7-methoxy-2-(7-methoxy-2H-1,3-benzodioxol-5-yl)-3-methyl-2,3-dihydro-1-benzofuran-5-yl]prop-2-en-1-ol → ({3-[7-methoxy-2-(7-methoxy-2H-1,3-benzodioxol-5-yl)-3-methyl-2,3-dihydro-1-benzofuran-5-yl]prop-2-en-1-yl}oxy)sulfonic acid details
[7-methoxy-2-(7-methoxy-2H-1,3-benzodioxol-5-yl)-5-(prop-1-en-1-yl)-2,3-dihydro-1-benzofuran-3-yl]methanol → {[7-methoxy-2-(7-methoxy-2H-1,3-benzodioxol-5-yl)-5-(prop-1-en-1-yl)-2,3-dihydro-1-benzofuran-3-yl]methoxy}sulfonic acid details
Isocarlinoside → ({6-[2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-4-oxo-6-(3,4,5-trihydroxyoxan-2-yl)-4H-chromen-8-yl]-3,4,5-trihydroxyoxan-2-yl}methoxy)sulfonic acid details
Isocarlinoside → {2-[2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-4-oxo-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-6-yl]-4,5-dihydroxyoxan-3-yl}oxidanesulfonic acid details
Isocarlinoside → {2-[2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-4-oxo-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-6-yl]-3,5-dihydroxyoxan-4-yl}oxidanesulfonic acid details
Isocarlinoside → {6-[2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-4-oxo-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-6-yl]-4,5-dihydroxyoxan-3-yl}oxidanesulfonic acid details
Isocarlinoside → {6-[2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-4-oxo-6-(3,4,5-trihydroxyoxan-2-yl)-4H-chromen-8-yl]-4,5-dihydroxy-2-(hydroxymethyl)oxan-3-yl}oxidanesulfonic acid details
Isocarlinoside → {2-[2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-4-oxo-6-(3,4,5-trihydroxyoxan-2-yl)-4H-chromen-8-yl]-3,5-dihydroxy-6-(hydroxymethyl)oxan-4-yl}oxidanesulfonic acid details
Isocarlinoside → {2-[2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-4-oxo-6-(3,4,5-trihydroxyoxan-2-yl)-4H-chromen-8-yl]-4,5-dihydroxy-6-(hydroxymethyl)oxan-3-yl}oxidanesulfonic acid details
5,7-dihydroxy-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-6-(3,4,5-trihydroxyoxan-2-yl)-2-(2,4,5-trihydroxyphenyl)-4H-chromen-4-one → ({6-[5,7-dihydroxy-4-oxo-6-(3,4,5-trihydroxyoxan-2-yl)-2-(2,4,5-trihydroxyphenyl)-4H-chromen-8-yl]-3,4,5-trihydroxyoxan-2-yl}methoxy)sulfonic acid details
5,7-dihydroxy-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-6-(3,4,5-trihydroxyoxan-2-yl)-2-(2,4,5-trihydroxyphenyl)-4H-chromen-4-one → (2-{5,7-dihydroxy-4-oxo-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-2-(2,4,5-trihydroxyphenyl)-4H-chromen-6-yl}-4,5-dihydroxyoxan-3-yl)oxidanesulfonic acid details
5,7-dihydroxy-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-6-(3,4,5-trihydroxyoxan-2-yl)-2-(2,4,5-trihydroxyphenyl)-4H-chromen-4-one → (2-{5,7-dihydroxy-4-oxo-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-2-(2,4,5-trihydroxyphenyl)-4H-chromen-6-yl}-3,5-dihydroxyoxan-4-yl)oxidanesulfonic acid details
5,7-dihydroxy-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-6-(3,4,5-trihydroxyoxan-2-yl)-2-(2,4,5-trihydroxyphenyl)-4H-chromen-4-one → (6-{5,7-dihydroxy-4-oxo-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-2-(2,4,5-trihydroxyphenyl)-4H-chromen-6-yl}-4,5-dihydroxyoxan-3-yl)oxidanesulfonic acid details
5,7-dihydroxy-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-6-(3,4,5-trihydroxyoxan-2-yl)-2-(2,4,5-trihydroxyphenyl)-4H-chromen-4-one → {6-[5,7-dihydroxy-4-oxo-6-(3,4,5-trihydroxyoxan-2-yl)-2-(2,4,5-trihydroxyphenyl)-4H-chromen-8-yl]-4,5-dihydroxy-2-(hydroxymethyl)oxan-3-yl}oxidanesulfonic acid details
5,7-dihydroxy-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-6-(3,4,5-trihydroxyoxan-2-yl)-2-(2,4,5-trihydroxyphenyl)-4H-chromen-4-one → {2-[5,7-dihydroxy-4-oxo-6-(3,4,5-trihydroxyoxan-2-yl)-2-(2,4,5-trihydroxyphenyl)-4H-chromen-8-yl]-3,5-dihydroxy-6-(hydroxymethyl)oxan-4-yl}oxidanesulfonic acid details
5,7-dihydroxy-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-6-(3,4,5-trihydroxyoxan-2-yl)-2-(2,4,5-trihydroxyphenyl)-4H-chromen-4-one → {2-[5,7-dihydroxy-4-oxo-6-(3,4,5-trihydroxyoxan-2-yl)-2-(2,4,5-trihydroxyphenyl)-4H-chromen-8-yl]-4,5-dihydroxy-6-(hydroxymethyl)oxan-3-yl}oxidanesulfonic acid details
5,7-dihydroxy-2-(3-hydroxyphenyl)-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-6-(3,4,5-trihydroxyoxan-2-yl)-4H-chromen-4-one → ({6-[5,7-dihydroxy-2-(3-hydroxyphenyl)-4-oxo-6-(3,4,5-trihydroxyoxan-2-yl)-4H-chromen-8-yl]-3,4,5-trihydroxyoxan-2-yl}methoxy)sulfonic acid details
5,7-dihydroxy-2-(3-hydroxyphenyl)-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-6-(3,4,5-trihydroxyoxan-2-yl)-4H-chromen-4-one → {2-[5,7-dihydroxy-2-(3-hydroxyphenyl)-4-oxo-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-6-yl]-4,5-dihydroxyoxan-3-yl}oxidanesulfonic acid details
5,7-dihydroxy-2-(3-hydroxyphenyl)-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-6-(3,4,5-trihydroxyoxan-2-yl)-4H-chromen-4-one → {2-[5,7-dihydroxy-2-(3-hydroxyphenyl)-4-oxo-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-6-yl]-3,5-dihydroxyoxan-4-yl}oxidanesulfonic acid details
5,7-dihydroxy-2-(3-hydroxyphenyl)-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-6-(3,4,5-trihydroxyoxan-2-yl)-4H-chromen-4-one → {6-[5,7-dihydroxy-2-(3-hydroxyphenyl)-4-oxo-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-6-yl]-4,5-dihydroxyoxan-3-yl}oxidanesulfonic acid details
5,7-dihydroxy-2-(3-hydroxyphenyl)-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-6-(3,4,5-trihydroxyoxan-2-yl)-4H-chromen-4-one → {6-[5,7-dihydroxy-2-(3-hydroxyphenyl)-4-oxo-6-(3,4,5-trihydroxyoxan-2-yl)-4H-chromen-8-yl]-4,5-dihydroxy-2-(hydroxymethyl)oxan-3-yl}oxidanesulfonic acid details
5,7-dihydroxy-2-(3-hydroxyphenyl)-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-6-(3,4,5-trihydroxyoxan-2-yl)-4H-chromen-4-one → {2-[5,7-dihydroxy-2-(3-hydroxyphenyl)-4-oxo-6-(3,4,5-trihydroxyoxan-2-yl)-4H-chromen-8-yl]-3,5-dihydroxy-6-(hydroxymethyl)oxan-4-yl}oxidanesulfonic acid details
5,7-dihydroxy-2-(3-hydroxyphenyl)-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-6-(3,4,5-trihydroxyoxan-2-yl)-4H-chromen-4-one → {2-[5,7-dihydroxy-2-(3-hydroxyphenyl)-4-oxo-6-(3,4,5-trihydroxyoxan-2-yl)-4H-chromen-8-yl]-4,5-dihydroxy-6-(hydroxymethyl)oxan-3-yl}oxidanesulfonic acid details
12-hydroxy-2-methoxy-11-(2-methoxyphenyl)-4,6,10-trioxatricyclo[7.4.0.0³,⁷]trideca-1,3(7),8-trien-13-one → [2-methoxy-11-(2-methoxyphenyl)-13-oxo-4,6,10-trioxatricyclo[7.4.0.0³,⁷]trideca-1,3(7),8-trien-12-yl]oxidanesulfonic acid details
2-methoxy-11-(2-methoxyphenyl)-4,6,10-trioxatricyclo[7.4.0.0³,⁷]trideca-1,3(7),8-trien-13-ol → [2-methoxy-11-(2-methoxyphenyl)-4,6,10-trioxatricyclo[7.4.0.0³,⁷]trideca-1,3(7),8-trien-13-yl]oxidanesulfonic acid details
7-hydroxy-6-(4-hydroxy-3-methylbut-2-en-1-yl)-8-methoxy-3-(2-methylbut-3-en-2-yl)-2H-chromen-2-one → ({4-[7-hydroxy-8-methoxy-3-(2-methylbut-3-en-2-yl)-2-oxo-2H-chromen-6-yl]-2-methylbut-2-en-1-yl}oxy)sulfonic acid details
7-hydroxy-3-(1-hydroxy-2-methylbut-3-en-2-yl)-8-methoxy-6-(3-methylbut-2-en-1-yl)-2H-chromen-2-one → ({2-[7-hydroxy-8-methoxy-6-(3-methylbut-2-en-1-yl)-2-oxo-2H-chromen-3-yl]-2-methylbut-3-en-1-yl}oxy)sulfonic acid details
7-hydroxy-6-[(2E)-4-hydroxy-3-methylbut-2-en-1-yl]-3-(2-methylbut-3-en-2-yl)-2H-chromen-2-one → {[(2E)-4-[7-hydroxy-3-(2-methylbut-3-en-2-yl)-2-oxo-2H-chromen-6-yl]-2-methylbut-2-en-1-yl]oxy}sulfonic acid details
7-hydroxy-6-(4-hydroxy-3-methylbut-2-en-1-yl)-3-(2-methylbut-3-en-2-yl)-2H-chromen-2-one → ({4-[7-hydroxy-3-(2-methylbut-3-en-2-yl)-2-oxo-2H-chromen-6-yl]-2-methylbut-2-en-1-yl}oxy)sulfonic acid details
7-hydroxy-3-(1-hydroxy-2-methylbut-3-en-2-yl)-6-(3-methylbut-2-en-1-yl)-2H-chromen-2-one → ({2-[7-hydroxy-6-(3-methylbut-2-en-1-yl)-2-oxo-2H-chromen-3-yl]-2-methylbut-3-en-1-yl}oxy)sulfonic acid details
10-[(2E)-4-hydroxy-3-methylbut-2-en-1-yl]-8,8-dimethyl-3-(2-methylbut-3-en-2-yl)-2H,8H-pyrano[3,2-g]chromen-2-one → {[(2E)-4-[2,2-dimethyl-7-(2-methylbut-3-en-2-yl)-8-oxo-2H,8H-pyrano[3,2-g]chromen-10-yl]-2-methylbut-2-en-1-yl]oxy}sulfonic acid details
10-(4-hydroxy-3-methylbut-2-en-1-yl)-8,8-dimethyl-3-(2-methylbut-3-en-2-yl)-2H,8H-pyrano[3,2-g]chromen-2-one → ({4-[2,2-dimethyl-7-(2-methylbut-3-en-2-yl)-8-oxo-2H,8H-pyrano[3,2-g]chromen-10-yl]-2-methylbut-2-en-1-yl}oxy)sulfonic acid details
3-(1-hydroxy-2-methylbut-3-en-2-yl)-8,8-dimethyl-10-(3-methylbut-2-en-1-yl)-2H,8H-pyrano[3,2-g]chromen-2-one → ({2-[8,8-dimethyl-10-(3-methylbut-2-en-1-yl)-2-oxo-2H,8H-pyrano[3,2-g]chromen-3-yl]-2-methylbut-3-en-1-yl}oxy)sulfonic acid details
8-(hydroxymethyl)-8-methyl-10-(3-methylbut-2-en-1-yl)-3-(2-methylbut-3-en-2-yl)-2H,8H-pyrano[3,2-g]chromen-2-one → {[2-methyl-10-(3-methylbut-2-en-1-yl)-7-(2-methylbut-3-en-2-yl)-8-oxo-2H,8H-pyrano[3,2-g]chromen-2-yl]methoxy}sulfonic acid details
3-(1-hydroxy-2-methylbut-3-en-2-yl)-7-methoxy-2H-chromen-2-one → {[2-(7-methoxy-2-oxo-2H-chromen-3-yl)-2-methylbut-3-en-1-yl]oxy}sulfonic acid details
4-{[(2E)-7-hydroxy-3,6,6-trimethylhept-2-en-1-yl]oxy}-7H-furo[3,2-g]chromen-7-one → {[(5E)-2,2,5-trimethyl-7-({7-oxo-7H-furo[3,2-g]chromen-4-yl}oxy)hept-5-en-1-yl]oxy}sulfonic acid details
4-{[(2Z)-7-hydroxy-3-(hydroxymethyl)-6,6-dimethylhept-2-en-1-yl]oxy}-7H-furo[3,2-g]chromen-7-one → {[(2Z)-6-hydroxy-5,5-dimethyl-2-[2-({7-oxo-7H-furo[3,2-g]chromen-4-yl}oxy)ethylidene]hexyl]oxy}sulfonic acid details
4-{[(2Z)-7-hydroxy-3-(hydroxymethyl)-6,6-dimethylhept-2-en-1-yl]oxy}-7H-furo[3,2-g]chromen-7-one → {[(5Z)-6-hydroxy-2,2-dimethyl-5-[2-({7-oxo-7H-furo[3,2-g]chromen-4-yl}oxy)ethylidene]hexyl]oxy}sulfonic acid details
4-{[(2E)-4,7-dihydroxy-3,6,6-trimethylhept-2-en-1-yl]oxy}-7H-furo[3,2-g]chromen-7-one → {[(5E)-4-hydroxy-2,2,5-trimethyl-7-({7-oxo-7H-furo[3,2-g]chromen-4-yl}oxy)hept-5-en-1-yl]oxy}sulfonic acid details
4-{[(2E)-4,7-dihydroxy-3,6,6-trimethylhept-2-en-1-yl]oxy}-7H-furo[3,2-g]chromen-7-one → {[(2E)-7-hydroxy-3,6,6-trimethyl-1-({7-oxo-7H-furo[3,2-g]chromen-4-yl}oxy)hept-2-en-4-yl]oxy}sulfonic acid details
4-{[3-(4-hydroxy-3,3-dimethylbutyl)-3-methyloxiran-2-yl]methoxy}-7H-furo[3,2-g]chromen-7-one → (2,2-dimethyl-4-{2-methyl-3-[({7-oxo-7H-furo[3,2-g]chromen-4-yl}oxy)methyl]oxiran-2-yl}butoxy)sulfonic acid details
4-{[(2E)-7-hydroxy-6-(hydroxymethyl)-3,6-dimethylhept-2-en-1-yl]oxy}-7H-furo[3,2-g]chromen-7-one → {3-hydroxy-2-methyl-2-[(3E)-3-methyl-5-({7-oxo-7H-furo[3,2-g]chromen-4-yl}oxy)pent-3-en-1-yl]propoxy}sulfonic acid details
(2E)-7-hydroxy-3,6,6-trimethylhept-2-enal → {[(5E)-2,2,5-trimethyl-7-oxohept-5-en-1-yl]oxy}sulfonic acid details
(5E)-4-hydroxy-2,2,5-trimethyl-7-({7-oxo-7H-furo[3,2-g]chromen-4-yl}oxy)hept-5-enoic acid → (5E)-2,2,5-trimethyl-7-({7-oxo-7H-furo[3,2-g]chromen-4-yl}oxy)-4-(sulfooxy)hept-5-enoic acid details
(5Z)-5-(hydroxymethyl)-2,2-dimethyl-7-({7-oxo-7H-furo[3,2-g]chromen-4-yl}oxy)hept-5-enoic acid → (5Z)-2,2-dimethyl-7-({7-oxo-7H-furo[3,2-g]chromen-4-yl}oxy)-5-[(sulfooxy)methyl]hept-5-enoic acid details
(5E)-2-(hydroxymethyl)-2,5-dimethyl-7-({7-oxo-7H-furo[3,2-g]chromen-4-yl}oxy)hept-5-enoic acid → (5E)-2,5-dimethyl-7-({7-oxo-7H-furo[3,2-g]chromen-4-yl}oxy)-2-[(sulfooxy)methyl]hept-5-enoic acid details
(R)-Heraclenol → {[3-hydroxy-3-methyl-1-({7-oxo-7H-furo[3,2-g]chromen-9-yl}oxy)butan-2-yl]oxy}sulfonic acid details
26-hydroxyhexacosyl 3-(3,4-dihydroxyphenyl)prop-2-enoate → [(26-{[3-(3,4-dihydroxyphenyl)prop-2-enoyl]oxy}hexacosyl)oxy]sulfonic acid details
26-hydroxyhexacosyl (2E)-3-(3,4-dihydroxyphenyl)prop-2-enoate → [(26-{[(2E)-3-(3,4-dihydroxyphenyl)prop-2-enoyl]oxy}hexacosyl)oxy]sulfonic acid details
1,26-Hexacosanediol → [(26-hydroxyhexacosyl)oxy]sulfonic acid details
Aflatoxin Q1 → {11-methoxy-16,18-dioxo-6,8,19-trioxapentacyclo[10.7.0.0²,⁹.0³,⁷.0¹³,¹⁷]nonadeca-1(12),2(9),4,10,13(17)-pentaen-14-yl}oxidanesulfonic acid details
11,14-dihydroxy-6,8,19-trioxapentacyclo[10.7.0.0²,⁹.0³,⁷.0¹³,¹⁷]nonadeca-1(12),2(9),4,10,13(17)-pentaene-16,18-dione → {11-hydroxy-16,18-dioxo-6,8,19-trioxapentacyclo[10.7.0.0²,⁹.0³,⁷.0¹³,¹⁷]nonadeca-1(12),2(9),4,10,13(17)-pentaen-14-yl}oxidanesulfonic acid details
3-hydroxy-1-(2-hydroxy-4,6-dimethoxy-3-methylphenyl)-3-phenylpropan-1-one → [3-(2-hydroxy-4,6-dimethoxy-3-methylphenyl)-3-oxo-1-phenylpropoxy]sulfonic acid details
1-[2-hydroxy-3-(hydroxymethyl)-4,6-dimethoxyphenyl]-3-phenylpropan-1-one → {[2-hydroxy-4,6-dimethoxy-3-(3-phenylpropanoyl)phenyl]methoxy}sulfonic acid details
2-(1-hydroxy-3-phenylpropyl)-3,5-dimethoxy-6-methylphenol → [1-(2-hydroxy-4,6-dimethoxy-3-methylphenyl)-3-phenylpropoxy]sulfonic acid details
2-(hydroxymethyl)-3,5-dimethoxyphenol → [(2-hydroxy-4,6-dimethoxyphenyl)methoxy]sulfonic acid details
3-hydroxy-3-phenylpropanoic acid → 3-phenyl-3-(sulfooxy)propanoic acid details
2-hydroxy-2-phenylacetic acid → 2-phenyl-2-(sulfooxy)acetic acid details
5,7,11,14,18-pentaoxahexacyclo[11.11.0.0²,¹⁰.0⁴,⁸.0¹⁵,²³.0¹⁷,²¹]tetracosa-2,4(8),9,15(23),16,19,21-heptaene-1,24-diol → {1-hydroxy-5,7,11,14,18-pentaoxahexacyclo[11.11.0.0²,¹⁰.0⁴,⁸.0¹⁵,²³.0¹⁷,²¹]tetracosa-2,4(8),9,15(23),16,19,21-heptaen-24-yl}oxidanesulfonic acid details
Ethanol → Ethyl hydrogen sulfate details
2-hydroxyethyl (2E)-3-(4-methoxyphenyl)prop-2-enoate → (2-{[(2E)-3-(4-methoxyphenyl)prop-2-enoyl]oxy}ethoxy)sulfonic acid details
Ethylene glycol → (2-hydroxyethoxy)sulfonic acid details
6-[1-hydroxy-2-(3-hydroxy-4-methoxyphenyl)ethyl]-4-methoxyoxan-2-one → [2-(3-hydroxy-4-methoxyphenyl)-1-(4-methoxy-6-oxooxan-2-yl)ethoxy]sulfonic acid details
6-[2-hydroxy-2-(3-hydroxy-4-methoxyphenyl)ethyl]-4-methoxyoxan-2-one → [1-(3-hydroxy-4-methoxyphenyl)-2-(4-methoxy-6-oxooxan-2-yl)ethoxy]sulfonic acid details
3-hydroxy-6-[2-(3-hydroxy-4-methoxyphenyl)ethyl]-4-methoxyoxan-2-one → {6-[2-(3-hydroxy-4-methoxyphenyl)ethyl]-4-methoxy-2-oxooxan-3-yl}oxidanesulfonic acid details
6-(hydroxymethyl)-6-methyl-5,12,20-trioxapentacyclo[11.8.0.0²,¹¹.0⁴,⁹.0¹⁴,¹⁹]henicosa-2(11),3,7,9,14(19),15,17-heptaene-1,17-diol → ({1,17-dihydroxy-6-methyl-5,12,20-trioxapentacyclo[11.8.0.0²,¹¹.0⁴,⁹.0¹⁴,¹⁹]henicosa-2(11),3,7,9,14(19),15,17-heptaen-6-yl}methoxy)sulfonic acid details
Demethoxyegonol → {3-[2-(2H-1,3-benzodioxol-5-yl)-1-benzofuran-5-yl]propoxy}sulfonic acid details
3-[2-(2H-1,3-benzodioxol-5-yl)-1-benzofuran-5-yl]propane-1,2-diol → {3-[2-(2H-1,3-benzodioxol-5-yl)-1-benzofuran-5-yl]-2-hydroxypropoxy}sulfonic acid details
3-[2-(2H-1,3-benzodioxol-5-yl)-1-benzofuran-5-yl]propane-1,2-diol → ({1-[2-(2H-1,3-benzodioxol-5-yl)-1-benzofuran-5-yl]-3-hydroxypropan-2-yl}oxy)sulfonic acid details
1-[2-(2H-1,3-benzodioxol-5-yl)-1-benzofuran-5-yl]propane-1,3-diol → {3-[2-(2H-1,3-benzodioxol-5-yl)-1-benzofuran-5-yl]-3-hydroxypropoxy}sulfonic acid details
1-[2-(2H-1,3-benzodioxol-5-yl)-1-benzofuran-5-yl]propane-1,3-diol → {1-[2-(2H-1,3-benzodioxol-5-yl)-1-benzofuran-5-yl]-3-hydroxypropoxy}sulfonic acid details
2-(2H-1,3-benzodioxol-5-yl)-5-(3-hydroxypropyl)-1-benzofuran-6-ol → {3-[2-(2H-1,3-benzodioxol-5-yl)-6-hydroxy-1-benzofuran-5-yl]propoxy}sulfonic acid details
6-[5-(3-hydroxypropyl)-1-benzofuran-2-yl]-2H-1,3-benzodioxol-5-ol → {3-[2-(6-hydroxy-2H-1,3-benzodioxol-5-yl)-1-benzofuran-5-yl]propoxy}sulfonic acid details
2-(2H-1,3-benzodioxol-5-yl)-5-(3-hydroxypropyl)-1-benzofuran-7-ol → {3-[2-(2H-1,3-benzodioxol-5-yl)-7-hydroxy-1-benzofuran-5-yl]propoxy}sulfonic acid details
2-(2H-1,3-benzodioxol-5-yl)-5-(3-hydroxypropyl)-1-benzofuran-4-ol → {3-[2-(2H-1,3-benzodioxol-5-yl)-4-hydroxy-1-benzofuran-5-yl]propoxy}sulfonic acid details
4-[5-(3-hydroxypropyl)-1-benzofuran-2-yl]benzene-1,2-diol → {3-[2-(3,4-dihydroxyphenyl)-1-benzofuran-5-yl]propoxy}sulfonic acid details
3-[2-(2H-1,3-benzodioxol-5-yl)-1-benzofuran-5-yl]-3-hydroxypropanal → {1-[2-(2H-1,3-benzodioxol-5-yl)-1-benzofuran-5-yl]-3-oxopropoxy}sulfonic acid details
3-[2-(2H-1,3-benzodioxol-5-yl)-1-benzofuran-5-yl]-2-hydroxypropanal → ({1-[2-(2H-1,3-benzodioxol-5-yl)-1-benzofuran-5-yl]-3-oxopropan-2-yl}oxy)sulfonic acid details
16-methoxy-5,7,11,14,18-pentaoxahexacyclo[11.11.0.0²,¹⁰.0⁴,⁸.0¹⁵,²³.0¹⁷,²¹]tetracosa-2,4(8),9,15(23),16,19,21-heptaene-1,24-diol → {1-hydroxy-16-methoxy-5,7,11,14,18-pentaoxahexacyclo[11.11.0.0²,¹⁰.0⁴,⁸.0¹⁵,²³.0¹⁷,²¹]tetracosa-2,4(8),9,15(23),16,19,21-heptaen-24-yl}oxidanesulfonic acid details
5,7-dihydroxy-8-(4-hydroxy-3-methylbut-2-en-1-yl)-4-phenyl-2H-chromen-2-one → {[4-(5,7-dihydroxy-2-oxo-4-phenyl-2H-chromen-8-yl)-2-methylbut-2-en-1-yl]oxy}sulfonic acid details
5,7-dihydroxy-6-(4-hydroxy-3-methylbut-2-en-1-yl)-4-phenyl-2H-chromen-2-one → {[4-(5,7-dihydroxy-2-oxo-4-phenyl-2H-chromen-6-yl)-2-methylbut-2-en-1-yl]oxy}sulfonic acid details
5,7-dihydroxy-8-(4-hydroxy-3-methylbut-2-en-1-yl)-4-propyl-2H-chromen-2-one → {[4-(5,7-dihydroxy-2-oxo-4-propyl-2H-chromen-8-yl)-2-methylbut-2-en-1-yl]oxy}sulfonic acid details
5,7-dihydroxy-4-(1-hydroxypropyl)-8-(3-methylbut-2-en-1-yl)-2H-chromen-2-one → {1-[5,7-dihydroxy-8-(3-methylbut-2-en-1-yl)-2-oxo-2H-chromen-4-yl]propoxy}sulfonic acid details
5,7-dihydroxy-4-(2-hydroxypropyl)-8-(3-methylbut-2-en-1-yl)-2H-chromen-2-one → ({1-[5,7-dihydroxy-8-(3-methylbut-2-en-1-yl)-2-oxo-2H-chromen-4-yl]propan-2-yl}oxy)sulfonic acid details
5,7-dihydroxy-4-(3-hydroxypropyl)-8-(3-methylbut-2-en-1-yl)-2H-chromen-2-one → {3-[5,7-dihydroxy-8-(3-methylbut-2-en-1-yl)-2-oxo-2H-chromen-4-yl]propoxy}sulfonic acid details
5,7-dihydroxy-6-(4-hydroxy-3-methylbut-2-en-1-yl)-4-propyl-2H-chromen-2-one → {[4-(5,7-dihydroxy-2-oxo-4-propyl-2H-chromen-6-yl)-2-methylbut-2-en-1-yl]oxy}sulfonic acid details
5,7-dihydroxy-4-(1-hydroxypropyl)-6-(3-methylbut-2-en-1-yl)-2H-chromen-2-one → {1-[5,7-dihydroxy-6-(3-methylbut-2-en-1-yl)-2-oxo-2H-chromen-4-yl]propoxy}sulfonic acid details
5,7-dihydroxy-4-(2-hydroxypropyl)-6-(3-methylbut-2-en-1-yl)-2H-chromen-2-one → ({1-[5,7-dihydroxy-6-(3-methylbut-2-en-1-yl)-2-oxo-2H-chromen-4-yl]propan-2-yl}oxy)sulfonic acid details
5,7-dihydroxy-4-(3-hydroxypropyl)-6-(3-methylbut-2-en-1-yl)-2H-chromen-2-one → {3-[5,7-dihydroxy-6-(3-methylbut-2-en-1-yl)-2-oxo-2H-chromen-4-yl]propoxy}sulfonic acid details
5-hydroxy-8-(hydroxymethyl)-8-methyl-6-(3-methylbutanoyl)-4-phenyl-2H,8H-pyrano[2,3-f]chromen-2-one → {[5-hydroxy-8-methyl-6-(3-methylbutanoyl)-2-oxo-4-phenyl-2H,8H-pyrano[2,3-f]chromen-8-yl]methoxy}sulfonic acid details
5-hydroxy-6-(4-hydroxy-3-methylbutanoyl)-8,8-dimethyl-4-phenyl-2H,8H-pyrano[2,3-f]chromen-2-one → (4-{5-hydroxy-8,8-dimethyl-2-oxo-4-phenyl-2H,8H-pyrano[2,3-f]chromen-6-yl}-2-methyl-4-oxobutoxy)sulfonic acid details
5-hydroxy-8-(hydroxymethyl)-8-methyl-4-phenyl-2H,8H-pyrano[2,3-f]chromen-2-one → ({5-hydroxy-8-methyl-2-oxo-4-phenyl-2H,8H-pyrano[2,3-f]chromen-8-yl}methoxy)sulfonic acid details
3-hydroxy-2-(2-hydroxypropan-2-yl)-2H,3H,7H-furo[3,2-g]chromen-7-one → [2-(2-hydroxypropan-2-yl)-7-oxo-2H,3H,7H-furo[3,2-g]chromen-3-yl]oxidanesulfonic acid details
Dorsteniol → (2-hydroxy-2-{7-oxo-2H,3H,7H-furo[3,2-g]chromen-2-yl}propoxy)sulfonic acid details
8-(3-hydroxy-2,2-dimethylpropyl)-7-methoxy-2H-chromen-2-one → [3-(7-methoxy-2-oxo-2H-chromen-8-yl)-2,2-dimethylpropoxy]sulfonic acid details
3-hydroxy-3-(7-methoxy-2-oxo-2H-chromen-8-yl)-2,2-dimethylpropanal → [1-(7-methoxy-2-oxo-2H-chromen-8-yl)-2,2-dimethyl-3-oxopropoxy]sulfonic acid details
3-hydroxy-2-[(7-methoxy-2-oxo-2H-chromen-8-yl)methyl]-2-methylpropanal → {2-[(7-methoxy-2-oxo-2H-chromen-8-yl)methyl]-2-methyl-3-oxopropoxy}sulfonic acid details
8-(1,3-dihydroxy-2,2-dimethylpropyl)-7-methoxy-2H-chromen-2-one → [3-hydroxy-3-(7-methoxy-2-oxo-2H-chromen-8-yl)-2,2-dimethylpropoxy]sulfonic acid details
8-(1,3-dihydroxy-2,2-dimethylpropyl)-7-methoxy-2H-chromen-2-one → [3-hydroxy-1-(7-methoxy-2-oxo-2H-chromen-8-yl)-2,2-dimethylpropoxy]sulfonic acid details
6-hydroxy-8-(3-hydroxy-2,2-dimethylpropyl)-7-methoxy-2H-chromen-2-one → [3-(6-hydroxy-7-methoxy-2-oxo-2H-chromen-8-yl)-2,2-dimethylpropoxy]sulfonic acid details
7-hydroxy-8-(3-hydroxy-2,2-dimethylpropyl)-2H-chromen-2-one → [3-(7-hydroxy-2-oxo-2H-chromen-8-yl)-2,2-dimethylpropoxy]sulfonic acid details
8-[3-hydroxy-2-(hydroxymethyl)-2-methylpropyl]-7-methoxy-2H-chromen-2-one → {3-hydroxy-2-[(7-methoxy-2-oxo-2H-chromen-8-yl)methyl]-2-methylpropoxy}sulfonic acid details
3-hydroxy-3-(7-methoxy-2-oxo-2H-chromen-8-yl)-2,2-dimethylpropanoic acid → 3-(7-methoxy-2-oxo-2H-chromen-8-yl)-2,2-dimethyl-3-(sulfooxy)propanoic acid details
3-hydroxy-2-[(7-methoxy-2-oxo-2H-chromen-8-yl)methyl]-2-methylpropanoic acid → 2-[(7-methoxy-2-oxo-2H-chromen-8-yl)methyl]-2-methyl-3-(sulfooxy)propanoic acid details
6-[2-(2H-1,3-benzodioxol-5-yl)-1-hydroxyethyl]-4-methoxy-5,6-dihydro-2H-pyran-2-one → [2-(2H-1,3-benzodioxol-5-yl)-1-(4-methoxy-6-oxo-3,6-dihydro-2H-pyran-2-yl)ethoxy]sulfonic acid details
6-[2-(2H-1,3-benzodioxol-5-yl)-2-hydroxyethyl]-4-methoxy-5,6-dihydro-2H-pyran-2-one → [1-(2H-1,3-benzodioxol-5-yl)-2-(4-methoxy-6-oxo-3,6-dihydro-2H-pyran-2-yl)ethoxy]sulfonic acid details
6-[2-(2H-1,3-benzodioxol-5-yl)ethyl]-5-hydroxy-4-methoxy-5,6-dihydro-2H-pyran-2-one → {2-[2-(2H-1,3-benzodioxol-5-yl)ethyl]-4-methoxy-6-oxo-3,6-dihydro-2H-pyran-3-yl}oxidanesulfonic acid details
6-[2-(2H-1,3-benzodioxol-5-yl)-1-hydroxyethyl]-4-methoxyoxan-2-one → [2-(2H-1,3-benzodioxol-5-yl)-1-(4-methoxy-6-oxooxan-2-yl)ethoxy]sulfonic acid details
6-[2-(2H-1,3-benzodioxol-5-yl)-2-hydroxyethyl]-4-methoxyoxan-2-one → [1-(2H-1,3-benzodioxol-5-yl)-2-(4-methoxy-6-oxooxan-2-yl)ethoxy]sulfonic acid details
6-[2-(2H-1,3-benzodioxol-5-yl)ethyl]-3-hydroxy-4-methoxyoxan-2-one → {6-[2-(2H-1,3-benzodioxol-5-yl)ethyl]-4-methoxy-2-oxooxan-3-yl}oxidanesulfonic acid details
6-[2-(2H-1,3-benzodioxol-5-yl)ethyl]-4-hydroxyoxan-2-one → {2-[2-(2H-1,3-benzodioxol-5-yl)ethyl]-6-oxooxan-4-yl}oxidanesulfonic acid details
2-(2,4-dihydroxyphenyl)-3,5,7-trihydroxy-3,4-dihydro-2H-1-benzopyran-4-one → [2-(2,4-dihydroxyphenyl)-5,7-dihydroxy-4-oxo-3,4-dihydro-2H-1-benzopyran-3-yl]oxidanesulfonic acid details
2-(2,4-dihydroxyphenyl)-3,5,6,7-tetrahydroxy-3,4-dihydro-2H-1-benzopyran-4-one → [2-(2,4-dihydroxyphenyl)-5,6,7-trihydroxy-4-oxo-3,4-dihydro-2H-1-benzopyran-3-yl]oxidanesulfonic acid details
3,5,7-trihydroxy-2-(2,4,5-trihydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-one → [5,7-dihydroxy-4-oxo-2-(2,4,5-trihydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-3-yl]oxidanesulfonic acid details
3,5,7-trihydroxy-2-(2,3,4-trihydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-one → [5,7-dihydroxy-4-oxo-2-(2,3,4-trihydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-3-yl]oxidanesulfonic acid details
3,7,15-trihydroxy-16,17-dimethoxytricyclo[12.3.1.1²,⁶]nonadeca-1(17),2,4,6(19),14(18),15-hexaen-9-one → {3,15-dihydroxy-16,17-dimethoxy-9-oxotricyclo[12.3.1.1²,⁶]nonadeca-1(17),2,4,6(19),14(18),15-hexaen-7-yl}oxidanesulfonic acid details
3,13,15-trihydroxy-16,17-dimethoxytricyclo[12.3.1.1²,⁶]nonadeca-1(18),2,4,6(19),14,16-hexaen-9-one → {5,17-dihydroxy-3,4-dimethoxy-11-oxotricyclo[12.3.1.1²,⁶]nonadeca-1(17),2(19),3,5,14(18),15-hexaen-7-yl}oxidanesulfonic acid details
3,10,15-trihydroxy-16,17-dimethoxytricyclo[12.3.1.1²,⁶]nonadeca-1(17),2,4,6(19),14(18),15-hexaen-9-one → {5,17-dihydroxy-3,4-dimethoxy-11-oxotricyclo[12.3.1.1²,⁶]nonadeca-1(17),2,4,6(19),14(18),15-hexaen-10-yl}oxidanesulfonic acid details
Hydroxymyricanone → {3,15-dihydroxy-16,17-dimethoxy-9-oxotricyclo[12.3.1.1²,⁶]nonadeca-1(17),2,4,6(19),14(18),15-hexaen-8-yl}oxidanesulfonic acid details
16,17-dimethoxytricyclo[12.3.1.1²,⁶]nonadeca-1(17),2,4,6(19),14(18),15-hexaene-3,9-diol → {3-hydroxy-16,17-dimethoxytricyclo[12.3.1.1²,⁶]nonadeca-1(17),2,4,6(19),14(18),15-hexaen-9-yl}oxidanesulfonic acid details
3,10-dihydroxy-16,17-dimethoxytricyclo[12.3.1.1²,⁶]nonadeca-1(17),2,4,6(19),14(18),15-hexaen-9-one → {17-hydroxy-3,4-dimethoxy-11-oxotricyclo[12.3.1.1²,⁶]nonadeca-1(17),2,4,6(19),14(18),15-hexaen-10-yl}oxidanesulfonic acid details
3,8-dihydroxy-16,17-dimethoxytricyclo[12.3.1.1²,⁶]nonadeca-1(17),2,4,6(19),14(18),15-hexaen-9-one → {3-hydroxy-16,17-dimethoxy-9-oxotricyclo[12.3.1.1²,⁶]nonadeca-1(17),2,4,6(19),14(18),15-hexaen-8-yl}oxidanesulfonic acid details
3,7-dihydroxy-16,17-dimethoxytricyclo[12.3.1.1²,⁶]nonadeca-1(17),2,4,6(19),14(18),15-hexaen-9-one → {3-hydroxy-16,17-dimethoxy-9-oxotricyclo[12.3.1.1²,⁶]nonadeca-1(17),2,4,6(19),14(18),15-hexaen-7-yl}oxidanesulfonic acid details
3,13-dihydroxy-16,17-dimethoxytricyclo[12.3.1.1²,⁶]nonadeca-1(17),2,4,6(19),14(18),15-hexaen-9-one → {17-hydroxy-3,4-dimethoxy-11-oxotricyclo[12.3.1.1²,⁶]nonadeca-1(17),2,4,6(19),14(18),15-hexaen-7-yl}oxidanesulfonic acid details
Corymboside → ({6-[5,7-dihydroxy-2-(4-hydroxyphenyl)-4-oxo-6-(3,4,5-trihydroxyoxan-2-yl)-4H-chromen-8-yl]-3,4,5-trihydroxyoxan-2-yl}methoxy)sulfonic acid details
Corymboside → {2-[5,7-dihydroxy-2-(4-hydroxyphenyl)-4-oxo-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-6-yl]-4,5-dihydroxyoxan-3-yl}oxidanesulfonic acid details
Corymboside → {2-[5,7-dihydroxy-2-(4-hydroxyphenyl)-4-oxo-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-6-yl]-3,5-dihydroxyoxan-4-yl}oxidanesulfonic acid details
Corymboside → {6-[5,7-dihydroxy-2-(4-hydroxyphenyl)-4-oxo-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-6-yl]-4,5-dihydroxyoxan-3-yl}oxidanesulfonic acid details
Corymboside → {6-[5,7-dihydroxy-2-(4-hydroxyphenyl)-4-oxo-6-(3,4,5-trihydroxyoxan-2-yl)-4H-chromen-8-yl]-4,5-dihydroxy-2-(hydroxymethyl)oxan-3-yl}oxidanesulfonic acid details
Corymboside → {2-[5,7-dihydroxy-2-(4-hydroxyphenyl)-4-oxo-6-(3,4,5-trihydroxyoxan-2-yl)-4H-chromen-8-yl]-3,5-dihydroxy-6-(hydroxymethyl)oxan-4-yl}oxidanesulfonic acid details
Corymboside → {2-[5,7-dihydroxy-2-(4-hydroxyphenyl)-4-oxo-6-(3,4,5-trihydroxyoxan-2-yl)-4H-chromen-8-yl]-4,5-dihydroxy-6-(hydroxymethyl)oxan-3-yl}oxidanesulfonic acid details
5,7-dihydroxy-2-phenyl-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-6-(3,4,5-trihydroxyoxan-2-yl)-4H-chromen-4-one → ({6-[5,7-dihydroxy-4-oxo-2-phenyl-6-(3,4,5-trihydroxyoxan-2-yl)-4H-chromen-8-yl]-3,4,5-trihydroxyoxan-2-yl}methoxy)sulfonic acid details
5,7-dihydroxy-2-phenyl-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-6-(3,4,5-trihydroxyoxan-2-yl)-4H-chromen-4-one → (2-{5,7-dihydroxy-4-oxo-2-phenyl-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-6-yl}-4,5-dihydroxyoxan-3-yl)oxidanesulfonic acid details
5,7-dihydroxy-2-phenyl-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-6-(3,4,5-trihydroxyoxan-2-yl)-4H-chromen-4-one → (2-{5,7-dihydroxy-4-oxo-2-phenyl-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-6-yl}-3,5-dihydroxyoxan-4-yl)oxidanesulfonic acid details
5,7-dihydroxy-2-phenyl-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-6-(3,4,5-trihydroxyoxan-2-yl)-4H-chromen-4-one → (6-{5,7-dihydroxy-4-oxo-2-phenyl-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-6-yl}-4,5-dihydroxyoxan-3-yl)oxidanesulfonic acid details
5,7-dihydroxy-2-phenyl-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-6-(3,4,5-trihydroxyoxan-2-yl)-4H-chromen-4-one → {6-[5,7-dihydroxy-4-oxo-2-phenyl-6-(3,4,5-trihydroxyoxan-2-yl)-4H-chromen-8-yl]-4,5-dihydroxy-2-(hydroxymethyl)oxan-3-yl}oxidanesulfonic acid details
5,7-dihydroxy-2-phenyl-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-6-(3,4,5-trihydroxyoxan-2-yl)-4H-chromen-4-one → {2-[5,7-dihydroxy-4-oxo-2-phenyl-6-(3,4,5-trihydroxyoxan-2-yl)-4H-chromen-8-yl]-3,5-dihydroxy-6-(hydroxymethyl)oxan-4-yl}oxidanesulfonic acid details
5,7-dihydroxy-2-phenyl-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-6-(3,4,5-trihydroxyoxan-2-yl)-4H-chromen-4-one → {2-[5,7-dihydroxy-4-oxo-2-phenyl-6-(3,4,5-trihydroxyoxan-2-yl)-4H-chromen-8-yl]-4,5-dihydroxy-6-(hydroxymethyl)oxan-3-yl}oxidanesulfonic acid details
2-(1,5-dihydroxy-4-oxocyclohex-2-en-1-yl)-5,6-dihydroxy-7-methoxy-4H-chromen-4-one → [5-(5,6-dihydroxy-7-methoxy-4-oxo-4H-chromen-2-yl)-5-hydroxy-2-oxocyclohex-3-en-1-yl]oxidanesulfonic acid details
2-(1,3-dihydroxy-4-oxocyclohexyl)-5,6-dihydroxy-7-methoxy-4H-chromen-4-one → [5-(5,6-dihydroxy-7-methoxy-4-oxo-4H-chromen-2-yl)-5-hydroxy-2-oxocyclohexyl]oxidanesulfonic acid details
(2R,3S)-Piscidic acid → 2-hydroxy-2-[(4-hydroxyphenyl)methyl]-3-(sulfooxy)butanedioic acid details
2-benzyl-2,3-dihydroxybutanedioic acid → 2-benzyl-2-hydroxy-3-(sulfooxy)butanedioic acid details
Porson → {15-hydroxy-3,16,17-trimethoxy-9-oxotricyclo[12.3.1.1²,⁶]nonadeca-1(17),2,4,6(19),14(18),15-hexaen-8-yl}oxidanesulfonic acid details
7,8,15-trihydroxy-3,16,17-trimethoxytricyclo[12.3.1.1²,⁶]nonadeca-1(17),2,4,6(19),14(18),15-hexaen-9-one → {8,15-dihydroxy-3,16,17-trimethoxy-9-oxotricyclo[12.3.1.1²,⁶]nonadeca-1(17),2,4,6(19),14(18),15-hexaen-7-yl}oxidanesulfonic acid details
7,8,15-trihydroxy-3,16,17-trimethoxytricyclo[12.3.1.1²,⁶]nonadeca-1(17),2,4,6(19),14(18),15-hexaen-9-one → {7,15-dihydroxy-3,16,17-trimethoxy-9-oxotricyclo[12.3.1.1²,⁶]nonadeca-1(17),2,4,6(19),14(18),15-hexaen-8-yl}oxidanesulfonic acid details
8,13,15-trihydroxy-3,16,17-trimethoxytricyclo[12.3.1.1²,⁶]nonadeca-1(18),2,4,6(19),14,16-hexaen-9-one → {5,12-dihydroxy-3,4,17-trimethoxy-11-oxotricyclo[12.3.1.1²,⁶]nonadeca-1(17),2(19),3,5,14(18),15-hexaen-7-yl}oxidanesulfonic acid details
8,13,15-trihydroxy-3,16,17-trimethoxytricyclo[12.3.1.1²,⁶]nonadeca-1(18),2,4,6(19),14,16-hexaen-9-one → {13,15-dihydroxy-3,16,17-trimethoxy-9-oxotricyclo[12.3.1.1²,⁶]nonadeca-1(18),2,4,6(19),14,16-hexaen-8-yl}oxidanesulfonic acid details
8,10,15-trihydroxy-3,16,17-trimethoxytricyclo[12.3.1.1²,⁶]nonadeca-1(17),2,4,6(19),14(18),15-hexaen-9-one → {5,12-dihydroxy-3,4,17-trimethoxy-11-oxotricyclo[12.3.1.1²,⁶]nonadeca-1(17),2,4,6(19),14(18),15-hexaen-10-yl}oxidanesulfonic acid details
8,10,15-trihydroxy-3,16,17-trimethoxytricyclo[12.3.1.1²,⁶]nonadeca-1(17),2,4,6(19),14(18),15-hexaen-9-one → {10,15-dihydroxy-3,16,17-trimethoxy-9-oxotricyclo[12.3.1.1²,⁶]nonadeca-1(17),2,4,6(19),14(18),15-hexaen-8-yl}oxidanesulfonic acid details
3,5,7,8-tetrahydroxy-2-(4-methoxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-one → [5,7,8-trihydroxy-2-(4-methoxyphenyl)-4-oxo-3,4-dihydro-2H-1-benzopyran-3-yl]oxidanesulfonic acid details
3,5,7-trihydroxy-2-(4-hydroxyphenyl)-8-methoxy-3,4-dihydro-2H-1-benzopyran-4-one → [5,7-dihydroxy-2-(4-hydroxyphenyl)-8-methoxy-4-oxo-3,4-dihydro-2H-1-benzopyran-3-yl]oxidanesulfonic acid details
3,5,7-trihydroxy-8-methoxy-2-phenyl-3,4-dihydro-2H-1-benzopyran-4-one → (5,7-dihydroxy-8-methoxy-4-oxo-2-phenyl-3,4-dihydro-2H-1-benzopyran-3-yl)oxidanesulfonic acid details
5,7-dihydroxy-4-(1-hydroxypropyl)-6-(3-methylbut-2-en-1-yl)-8-(2-methylbutanoyl)-2H-chromen-2-one → {1-[5,7-dihydroxy-6-(3-methylbut-2-en-1-yl)-8-(2-methylbutanoyl)-2-oxo-2H-chromen-4-yl]propoxy}sulfonic acid details
5,7-dihydroxy-4-(1-hydroxypropyl)-6-(3-methylbut-2-en-1-yl)-8-(3-methylbutanoyl)-2H-chromen-2-one → {1-[5,7-dihydroxy-6-(3-methylbut-2-en-1-yl)-8-(3-methylbutanoyl)-2-oxo-2H-chromen-4-yl]propoxy}sulfonic acid details
2-[2-hydroxy-3-(4-hydroxyphenyl)propyl]benzene-1,3,5-triol → {[1-(4-hydroxyphenyl)-3-(2,4,6-trihydroxyphenyl)propan-2-yl]oxy}sulfonic acid details
4-hydroxy-5-(4-hydroxyphenyl)pentanoic acid → 5-(4-hydroxyphenyl)-4-(sulfooxy)pentanoic acid details
2-(2-hydroxy-3-phenylpropyl)benzene-1,3,5-triol → {[1-phenyl-3-(2,4,6-trihydroxyphenyl)propan-2-yl]oxy}sulfonic acid details
4-Hydroxy-5-phenylpentanoic acid → 5-phenyl-4-(sulfooxy)pentanoic acid details
Hydroxyphenyllactic acid → 3-(4-hydroxyphenyl)-2-(sulfooxy)propanoic acid details
Afzelechin 7-apioside → [(5-{[3,5-dihydroxy-2-(4-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-7-yl]oxy}-3,4-dihydroxyoxolan-3-yl)methoxy]sulfonic acid details
Afzelechin 7-apioside → (2-{[3,5-dihydroxy-2-(4-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-7-yl]oxy}-4-hydroxy-4-(hydroxymethyl)oxolan-3-yl)oxidanesulfonic acid details
7-{[3,4-dihydroxy-4-(hydroxymethyl)oxolan-2-yl]oxy}-2-phenyl-3,4-dihydro-2H-1-benzopyran-3,5-diol → ({5-[(3,5-dihydroxy-2-phenyl-3,4-dihydro-2H-1-benzopyran-7-yl)oxy]-3,4-dihydroxyoxolan-3-yl}methoxy)sulfonic acid details
7-{[3,4-dihydroxy-4-(hydroxymethyl)oxolan-2-yl]oxy}-2-phenyl-3,4-dihydro-2H-1-benzopyran-3,5-diol → {2-[(3,5-dihydroxy-2-phenyl-3,4-dihydro-2H-1-benzopyran-7-yl)oxy]-4-hydroxy-4-(hydroxymethyl)oxolan-3-yl}oxidanesulfonic acid details
3,7,9-trihydroxy-1-(hydroxymethyl)-6H-benzo[c]chromen-6-one → ({3,7,9-trihydroxy-6-oxo-6H-benzo[c]chromen-1-yl}methoxy)sulfonic acid details
trans-3,3',4',5,5',7-Hexahydroxyflavanone → [5,7-dihydroxy-4-oxo-2-(3,4,5-trihydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-3-yl]oxidanesulfonic acid details
2-(3,5-dihydroxyphenyl)-3,5,7-trihydroxy-3,4-dihydro-2H-1-benzopyran-4-one → [2-(3,5-dihydroxyphenyl)-5,7-dihydroxy-4-oxo-3,4-dihydro-2H-1-benzopyran-3-yl]oxidanesulfonic acid details
3,5,7-trihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-one → [5,7-dihydroxy-2-(3-hydroxyphenyl)-4-oxo-3,4-dihydro-2H-1-benzopyran-3-yl]oxidanesulfonic acid details
Apiin → ({5-[(4,5-dihydroxy-2-{[5-hydroxy-2-(4-hydroxyphenyl)-4-oxo-4H-chromen-7-yl]oxy}-6-(hydroxymethyl)oxan-3-yl)oxy]-3,4-dihydroxyoxolan-3-yl}methoxy)sulfonic acid details
Apiin → {2-[(4,5-dihydroxy-2-{[5-hydroxy-2-(4-hydroxyphenyl)-4-oxo-4H-chromen-7-yl]oxy}-6-(hydroxymethyl)oxan-3-yl)oxy]-4-hydroxy-4-(hydroxymethyl)oxolan-3-yl}oxidanesulfonic acid details
2-{9-hydroxy-2-oxo-2H,8H,9H-furo[2,3-h]chromen-8-yl}propan-2-yl 2-methylbut-2-enoate → (8-{2-[(2-methylbut-2-enoyl)oxy]propan-2-yl}-2-oxo-2H,8H,9H-furo[2,3-h]chromen-9-yl)oxidanesulfonic acid details
1-hydroxy-2-(9-{[(2E)-2-methylbut-2-enoyl]oxy}-2-oxo-2H,8H,9H-furo[2,3-h]chromen-8-yl)propan-2-yl 2-methylbut-2-enoate → {2-[(2-methylbut-2-enoyl)oxy]-2-(9-{[(2E)-2-methylbut-2-enoyl]oxy}-2-oxo-2H,8H,9H-furo[2,3-h]chromen-8-yl)propoxy}sulfonic acid details
2-(hydroxymethyl)but-2-enoic acid → 2-[(sulfooxy)methyl]but-2-enoic acid details
1-hydroxy-2-{9-hydroxy-2-oxo-2H,8H,9H-furo[2,3-h]chromen-8-yl}propan-2-yl 2-methylbut-2-enoate → (2-{9-hydroxy-2-oxo-2H,8H,9H-furo[2,3-h]chromen-8-yl}-2-[(2-methylbut-2-enoyl)oxy]propoxy)sulfonic acid details
1-hydroxy-2-{9-hydroxy-2-oxo-2H,8H,9H-furo[2,3-h]chromen-8-yl}propan-2-yl 2-methylbut-2-enoate → (8-{1-hydroxy-2-[(2-methylbut-2-enoyl)oxy]propan-2-yl}-2-oxo-2H,8H,9H-furo[2,3-h]chromen-9-yl)oxidanesulfonic acid details
3,5,7-trihydroxy-2-(4-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-one → [5,7-dihydroxy-2-(4-hydroxyphenyl)-4-oxo-3,4-dihydro-2H-1-benzopyran-3-yl]oxidanesulfonic acid details
3,5,7-trihydroxy-2-phenyl-3,4-dihydro-2H-1-benzopyran-4-one → (5,7-dihydroxy-4-oxo-2-phenyl-3,4-dihydro-2H-1-benzopyran-3-yl)oxidanesulfonic acid details
2-(2,4-dihydroxyphenyl)-5,7-dihydroxy-6-(4-hydroxy-3-methylbut-2-en-1-yl)-4H-chromen-4-one → ({4-[2-(2,4-dihydroxyphenyl)-5,7-dihydroxy-4-oxo-4H-chromen-6-yl]-2-methylbut-2-en-1-yl}oxy)sulfonic acid details
2-(2,4-dihydroxyphenyl)-5,7-dihydroxy-6-[(2E)-4-hydroxy-3-methylbut-2-en-1-yl]-4H-chromen-4-one → {[(2E)-4-[2-(2,4-dihydroxyphenyl)-5,7-dihydroxy-4-oxo-4H-chromen-6-yl]-2-methylbut-2-en-1-yl]oxy}sulfonic acid details
2-(2,4-dihydroxyphenyl)-5,7-dihydroxy-6-(4-hydroxy-3-methylbut-2-en-1-yl)-3,4-dihydro-2H-1-benzopyran-4-one → ({4-[2-(2,4-dihydroxyphenyl)-5,7-dihydroxy-4-oxo-3,4-dihydro-2H-1-benzopyran-6-yl]-2-methylbut-2-en-1-yl}oxy)sulfonic acid details
3-(2,4-dihydroxyphenyl)-1-[2,4,6-trihydroxy-3-(4-hydroxy-3-methylbut-2-en-1-yl)phenyl]prop-2-en-1-one → [(4-{3-[3-(2,4-dihydroxyphenyl)prop-2-enoyl]-2,4,6-trihydroxyphenyl}-2-methylbut-2-en-1-yl)oxy]sulfonic acid details
2-(4-hydroxy-3-methylbut-2-en-1-yl)benzene-1,3,5-triol → {[2-methyl-4-(2,4,6-trihydroxyphenyl)but-2-en-1-yl]oxy}sulfonic acid details
3-(2,4-dihydroxyphenyl)-1-[2,4,6-trihydroxy-3-(4-hydroxy-3-methylbut-2-en-1-yl)phenyl]propan-1-one → [(4-{3-[3-(2,4-dihydroxyphenyl)propanoyl]-2,4,6-trihydroxyphenyl}-2-methylbut-2-en-1-yl)oxy]sulfonic acid details
2-(2,4-dihydroxyphenyl)-5,7-dihydroxy-6-[(2E)-4-hydroxy-3-methylbut-2-en-1-yl]-3,4-dihydro-2H-1-benzopyran-4-one → {[(2E)-4-[2-(2,4-dihydroxyphenyl)-5,7-dihydroxy-4-oxo-3,4-dihydro-2H-1-benzopyran-6-yl]-2-methylbut-2-en-1-yl]oxy}sulfonic acid details
3-(2,4-dihydroxyphenyl)-1-{2,4,6-trihydroxy-3-[(2E)-4-hydroxy-3-methylbut-2-en-1-yl]phenyl}prop-2-en-1-one → {[(2E)-4-{3-[3-(2,4-dihydroxyphenyl)prop-2-enoyl]-2,4,6-trihydroxyphenyl}-2-methylbut-2-en-1-yl]oxy}sulfonic acid details
2-[(2E)-4-hydroxy-3-methylbut-2-en-1-yl]benzene-1,3,5-triol → {[(2E)-2-methyl-4-(2,4,6-trihydroxyphenyl)but-2-en-1-yl]oxy}sulfonic acid details
3-(2,4-dihydroxyphenyl)-1-{2,4,6-trihydroxy-3-[(2E)-4-hydroxy-3-methylbut-2-en-1-yl]phenyl}propan-1-one → {[(2E)-4-{3-[3-(2,4-dihydroxyphenyl)propanoyl]-2,4,6-trihydroxyphenyl}-2-methylbut-2-en-1-yl]oxy}sulfonic acid details
Aspalathin → [(6-{3-[3-(3,4-dihydroxyphenyl)propanoyl]-2,4,6-trihydroxyphenyl}-3,4,5-trihydroxyoxan-2-yl)methoxy]sulfonic acid details
Aspalathin → (6-{3-[3-(3,4-dihydroxyphenyl)propanoyl]-2,4,6-trihydroxyphenyl}-4,5-dihydroxy-2-(hydroxymethyl)oxan-3-yl)oxidanesulfonic acid details
Aspalathin → (2-{3-[3-(3,4-dihydroxyphenyl)propanoyl]-2,4,6-trihydroxyphenyl}-3,5-dihydroxy-6-(hydroxymethyl)oxan-4-yl)oxidanesulfonic acid details
Aspalathin → (2-{3-[3-(3,4-dihydroxyphenyl)propanoyl]-2,4,6-trihydroxyphenyl}-4,5-dihydroxy-6-(hydroxymethyl)oxan-3-yl)oxidanesulfonic acid details
2-(hydroxymethyl)-6-(2,4,6-trihydroxyphenyl)oxane-3,4,5-triol → {[3,4,5-trihydroxy-6-(2,4,6-trihydroxyphenyl)oxan-2-yl]methoxy}sulfonic acid details
2-(hydroxymethyl)-6-(2,4,6-trihydroxyphenyl)oxane-3,4,5-triol → [4,5-dihydroxy-2-(hydroxymethyl)-6-(2,4,6-trihydroxyphenyl)oxan-3-yl]oxidanesulfonic acid details
2-(hydroxymethyl)-6-(2,4,6-trihydroxyphenyl)oxane-3,4,5-triol → [3,5-dihydroxy-2-(hydroxymethyl)-6-(2,4,6-trihydroxyphenyl)oxan-4-yl]oxidanesulfonic acid details
2-(hydroxymethyl)-6-(2,4,6-trihydroxyphenyl)oxane-3,4,5-triol → [4,5-dihydroxy-6-(hydroxymethyl)-2-(2,4,6-trihydroxyphenyl)oxan-3-yl]oxidanesulfonic acid details
3-(3-hydroxyphenyl)-1-{2,4,6-trihydroxy-3-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]phenyl}propan-1-one → [(3,4,5-trihydroxy-6-{2,4,6-trihydroxy-3-[3-(3-hydroxyphenyl)propanoyl]phenyl}oxan-2-yl)methoxy]sulfonic acid details
3-(3-hydroxyphenyl)-1-{2,4,6-trihydroxy-3-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]phenyl}propan-1-one → [4,5-dihydroxy-2-(hydroxymethyl)-6-{2,4,6-trihydroxy-3-[3-(3-hydroxyphenyl)propanoyl]phenyl}oxan-3-yl]oxidanesulfonic acid details
3-(3-hydroxyphenyl)-1-{2,4,6-trihydroxy-3-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]phenyl}propan-1-one → [3,5-dihydroxy-2-(hydroxymethyl)-6-{2,4,6-trihydroxy-3-[3-(3-hydroxyphenyl)propanoyl]phenyl}oxan-4-yl]oxidanesulfonic acid details
3-(3-hydroxyphenyl)-1-{2,4,6-trihydroxy-3-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]phenyl}propan-1-one → [4,5-dihydroxy-6-(hydroxymethyl)-2-{2,4,6-trihydroxy-3-[3-(3-hydroxyphenyl)propanoyl]phenyl}oxan-3-yl]oxidanesulfonic acid details
8-{[3-(hydroxymethyl)-3-methyloxiran-2-yl]methyl}-7-methoxy-2H-chromen-2-one → ({3-[(7-methoxy-2-oxo-2H-chromen-8-yl)methyl]-2-methyloxiran-2-yl}methoxy)sulfonic acid details
(S)-Auraptenol → {[1-(7-methoxy-2-oxo-2H-chromen-8-yl)-3-methylbut-3-en-2-yl]oxy}sulfonic acid details
6-hydroxy-8-(2-hydroxy-3-methylbut-3-en-1-yl)-7-methoxy-2H-chromen-2-one → {[1-(6-hydroxy-7-methoxy-2-oxo-2H-chromen-8-yl)-3-methylbut-3-en-2-yl]oxy}sulfonic acid details
7-hydroxy-8-(2-hydroxy-3-methylbut-3-en-1-yl)-2H-chromen-2-one → {[1-(7-hydroxy-2-oxo-2H-chromen-8-yl)-3-methylbut-3-en-2-yl]oxy}sulfonic acid details
8-(2,4-dihydroxy-3-methylidenebutyl)-7-methoxy-2H-chromen-2-one → [3-hydroxy-4-(7-methoxy-2-oxo-2H-chromen-8-yl)-2-methylidenebutoxy]sulfonic acid details
8-(2,4-dihydroxy-3-methylidenebutyl)-7-methoxy-2H-chromen-2-one → {[4-hydroxy-1-(7-methoxy-2-oxo-2H-chromen-8-yl)-3-methylidenebutan-2-yl]oxy}sulfonic acid details
8-(1,2-dihydroxy-3-methylbut-3-en-1-yl)-7-methoxy-2H-chromen-2-one → {[2-hydroxy-1-(7-methoxy-2-oxo-2H-chromen-8-yl)-3-methylbut-3-en-1-yl]oxy}sulfonic acid details
8-(1,2-dihydroxy-3-methylbut-3-en-1-yl)-7-methoxy-2H-chromen-2-one → {[1-hydroxy-1-(7-methoxy-2-oxo-2H-chromen-8-yl)-3-methylbut-3-en-2-yl]oxy}sulfonic acid details
8-[2-hydroxy-2-(2-methyloxiran-2-yl)ethyl]-7-methoxy-2H-chromen-2-one → [2-(7-methoxy-2-oxo-2H-chromen-8-yl)-1-(2-methyloxiran-2-yl)ethoxy]sulfonic acid details
Avicularin → [(5-{[2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-4-oxo-4H-chromen-3-yl]oxy}-3,4-dihydroxyoxolan-2-yl)methoxy]sulfonic acid details
Avicularin → (5-{[2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-4-oxo-4H-chromen-3-yl]oxy}-4-hydroxy-2-(hydroxymethyl)oxolan-3-yl)oxidanesulfonic acid details
Avicularin → (2-{[2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-4-oxo-4H-chromen-3-yl]oxy}-4-hydroxy-5-(hydroxymethyl)oxolan-3-yl)oxidanesulfonic acid details
3-{[3,4-dihydroxy-5-(hydroxymethyl)oxolan-2-yl]oxy}-2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-3,4-dihydro-2H-1-benzopyran-4-one → [(5-{[2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-4-oxo-3,4-dihydro-2H-1-benzopyran-3-yl]oxy}-3,4-dihydroxyoxolan-2-yl)methoxy]sulfonic acid details
3-{[3,4-dihydroxy-5-(hydroxymethyl)oxolan-2-yl]oxy}-2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-3,4-dihydro-2H-1-benzopyran-4-one → (5-{[2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-4-oxo-3,4-dihydro-2H-1-benzopyran-3-yl]oxy}-4-hydroxy-2-(hydroxymethyl)oxolan-3-yl)oxidanesulfonic acid details
3-{[3,4-dihydroxy-5-(hydroxymethyl)oxolan-2-yl]oxy}-2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-3,4-dihydro-2H-1-benzopyran-4-one → (2-{[2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-4-oxo-3,4-dihydro-2H-1-benzopyran-3-yl]oxy}-4-hydroxy-5-(hydroxymethyl)oxolan-3-yl)oxidanesulfonic acid details
3-{[3,4-dihydroxy-5-(hydroxymethyl)oxolan-2-yl]oxy}-5,7-dihydroxy-2-(3-hydroxyphenyl)-4H-chromen-4-one → [(5-{[5,7-dihydroxy-2-(3-hydroxyphenyl)-4-oxo-4H-chromen-3-yl]oxy}-3,4-dihydroxyoxolan-2-yl)methoxy]sulfonic acid details
3-{[3,4-dihydroxy-5-(hydroxymethyl)oxolan-2-yl]oxy}-5,7-dihydroxy-2-(3-hydroxyphenyl)-4H-chromen-4-one → (5-{[5,7-dihydroxy-2-(3-hydroxyphenyl)-4-oxo-4H-chromen-3-yl]oxy}-4-hydroxy-2-(hydroxymethyl)oxolan-3-yl)oxidanesulfonic acid details
3-{[3,4-dihydroxy-5-(hydroxymethyl)oxolan-2-yl]oxy}-5,7-dihydroxy-2-(3-hydroxyphenyl)-4H-chromen-4-one → (2-{[5,7-dihydroxy-2-(3-hydroxyphenyl)-4-oxo-4H-chromen-3-yl]oxy}-4-hydroxy-5-(hydroxymethyl)oxolan-3-yl)oxidanesulfonic acid details
3-{[3,4-dihydroxy-5-(hydroxymethyl)oxolan-2-yl]oxy}-5,7-dihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-one → [(5-{[5,7-dihydroxy-2-(3-hydroxyphenyl)-4-oxo-3,4-dihydro-2H-1-benzopyran-3-yl]oxy}-3,4-dihydroxyoxolan-2-yl)methoxy]sulfonic acid details
3-{[3,4-dihydroxy-5-(hydroxymethyl)oxolan-2-yl]oxy}-5,7-dihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-one → (5-{[5,7-dihydroxy-2-(3-hydroxyphenyl)-4-oxo-3,4-dihydro-2H-1-benzopyran-3-yl]oxy}-4-hydroxy-2-(hydroxymethyl)oxolan-3-yl)oxidanesulfonic acid details
3-{[3,4-dihydroxy-5-(hydroxymethyl)oxolan-2-yl]oxy}-5,7-dihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-one → (2-{[5,7-dihydroxy-2-(3-hydroxyphenyl)-4-oxo-3,4-dihydro-2H-1-benzopyran-3-yl]oxy}-4-hydroxy-5-(hydroxymethyl)oxolan-3-yl)oxidanesulfonic acid details
5,7-dihydroxy-2-[5-hydroxy-9-(hydroxymethyl)-13,13-dimethyl-8-oxatetracyclo[7.4.1.0²,⁷.0¹²,¹⁴]tetradeca-2(7),3,5-trien-4-yl]-3,4-dihydro-2H-1-benzopyran-4-one → {[4-(5,7-dihydroxy-4-oxo-3,4-dihydro-2H-1-benzopyran-2-yl)-5-hydroxy-13,13-dimethyl-8-oxatetracyclo[7.4.1.0²,⁷.0¹²,¹⁴]tetradeca-2(7),3,5-trien-9-yl]methoxy}sulfonic acid details
5,7-dihydroxy-2-[5-hydroxy-13-(hydroxymethyl)-9,13-dimethyl-8-oxatetracyclo[7.4.1.0²,⁷.0¹²,¹⁴]tetradeca-2(7),3,5-trien-4-yl]-3,4-dihydro-2H-1-benzopyran-4-one → {[4-(5,7-dihydroxy-4-oxo-3,4-dihydro-2H-1-benzopyran-2-yl)-5-hydroxy-9,13-dimethyl-8-oxatetracyclo[7.4.1.0²,⁷.0¹²,¹⁴]tetradeca-2(7),3,5-trien-13-yl]methoxy}sulfonic acid details
2-{5,10-dihydroxy-9,13,13-trimethyl-8-oxatetracyclo[7.4.1.0²,⁷.0¹²,¹⁴]tetradeca-2(7),3,5-trien-4-yl}-5,7-dihydroxy-3,4-dihydro-2H-1-benzopyran-4-one → [4-(5,7-dihydroxy-4-oxo-3,4-dihydro-2H-1-benzopyran-2-yl)-5-hydroxy-9,13,13-trimethyl-8-oxatetracyclo[7.4.1.0²,⁷.0¹²,¹⁴]tetradeca-2(7),3,5-trien-10-yl]oxidanesulfonic acid details
2-{5,11-dihydroxy-9,13,13-trimethyl-8-oxatetracyclo[7.4.1.0²,⁷.0¹²,¹⁴]tetradeca-2(7),3,5-trien-4-yl}-5,7-dihydroxy-3,4-dihydro-2H-1-benzopyran-4-one → [4-(5,7-dihydroxy-4-oxo-3,4-dihydro-2H-1-benzopyran-2-yl)-5-hydroxy-9,13,13-trimethyl-8-oxatetracyclo[7.4.1.0²,⁷.0¹²,¹⁴]tetradeca-2(7),3,5-trien-11-yl]oxidanesulfonic acid details
5,7-dihydroxy-2-[7-hydroxy-2-(hydroxymethyl)-2-(4-methylpent-3-en-1-yl)-2H-chromen-6-yl]-3,4-dihydro-2H-1-benzopyran-4-one → {[6-(5,7-dihydroxy-4-oxo-3,4-dihydro-2H-1-benzopyran-2-yl)-7-hydroxy-2-(4-methylpent-3-en-1-yl)-2H-chromen-2-yl]methoxy}sulfonic acid details
5,7-dihydroxy-2-[7-hydroxy-2-(1-hydroxy-4-methylpent-3-en-1-yl)-2-methyl-2H-chromen-6-yl]-3,4-dihydro-2H-1-benzopyran-4-one → ({1-[6-(5,7-dihydroxy-4-oxo-3,4-dihydro-2H-1-benzopyran-2-yl)-7-hydroxy-2-methyl-2H-chromen-2-yl]-4-methylpent-3-en-1-yl}oxy)sulfonic acid details
5,7-dihydroxy-2-[7-hydroxy-2-(5-hydroxy-4-methylpent-3-en-1-yl)-2-methyl-2H-chromen-6-yl]-3,4-dihydro-2H-1-benzopyran-4-one → ({5-[6-(5,7-dihydroxy-4-oxo-3,4-dihydro-2H-1-benzopyran-2-yl)-7-hydroxy-2-methyl-2H-chromen-2-yl]-2-methylpent-2-en-1-yl}oxy)sulfonic acid details
5,7-dihydroxy-2-{7-hydroxy-2-[(3E)-5-hydroxy-4-methylpent-3-en-1-yl]-2-methyl-2H-chromen-6-yl}-3,4-dihydro-2H-1-benzopyran-4-one → {[(2E)-5-[6-(5,7-dihydroxy-4-oxo-3,4-dihydro-2H-1-benzopyran-2-yl)-7-hydroxy-2-methyl-2H-chromen-2-yl]-2-methylpent-2-en-1-yl]oxy}sulfonic acid details
5,7-dihydroxy-2-[7-hydroxy-2-(2-hydroxy-4-methylpent-3-en-1-yl)-2-methyl-2H-chromen-6-yl]-3,4-dihydro-2H-1-benzopyran-4-one → ({1-[6-(5,7-dihydroxy-4-oxo-3,4-dihydro-2H-1-benzopyran-2-yl)-7-hydroxy-2-methyl-2H-chromen-2-yl]-4-methylpent-3-en-2-yl}oxy)sulfonic acid details
3,5,6,7-tetrahydroxy-2-(4-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-one → [5,6,7-trihydroxy-2-(4-hydroxyphenyl)-4-oxo-3,4-dihydro-2H-1-benzopyran-3-yl]oxidanesulfonic acid details
3,5,6,7-tetrahydroxy-2-phenyl-3,4-dihydro-2H-1-benzopyran-4-one → (5,6,7-trihydroxy-4-oxo-2-phenyl-3,4-dihydro-2H-1-benzopyran-3-yl)oxidanesulfonic acid details
2-(3,4-dihydroxyphenyl)-3,5,7-trihydroxy-3,4-dihydro-2H-1-benzopyran-4-one → [2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-4-oxo-3,4-dihydro-2H-1-benzopyran-3-yl]oxidanesulfonic acid details
2-(1,2-dihydroxypropan-2-yl)-9-hydroxy-2H,3H,7H-furo[3,2-g]chromen-7-one → (2-hydroxy-2-{9-hydroxy-7-oxo-2H,3H,7H-furo[3,2-g]chromen-2-yl}propoxy)sulfonic acid details
3,9-dihydroxy-2-(2-hydroxypropan-2-yl)-2H,3H,7H-furo[3,2-g]chromen-7-one → [9-hydroxy-2-(2-hydroxypropan-2-yl)-7-oxo-2H,3H,7H-furo[3,2-g]chromen-3-yl]oxidanesulfonic acid details
5-hydroxy-1-(4-methoxyphenyl)-4-methylpent-1-en-3-one → {[5-(4-methoxyphenyl)-2-methyl-3-oxopent-4-en-1-yl]oxy}sulfonic acid details
1-(4-methoxyphenyl)-4-methylpent-1-en-3-ol → {[1-(4-methoxyphenyl)-4-methylpent-1-en-3-yl]oxy}sulfonic acid details
1-hydroxy-1-(4-methoxyphenyl)-4-methylpentan-3-one → {[1-(4-methoxyphenyl)-4-methyl-3-oxopentyl]oxy}sulfonic acid details
1-hydroxy-5-(4-methoxyphenyl)-2-methylpentan-3-one → {[5-(4-methoxyphenyl)-2-methyl-3-oxopentyl]oxy}sulfonic acid details
2-hydroxy-1-(4-methoxyphenyl)-4-methylpentan-3-one → {[1-(4-methoxyphenyl)-4-methyl-3-oxopentan-2-yl]oxy}sulfonic acid details
1-(4-methoxyphenyl)-4-methylpentan-3-ol → {[1-(4-methoxyphenyl)-4-methylpentan-3-yl]oxy}sulfonic acid details
(1E)-4-hydroxy-1-(4-methoxyphenyl)pent-1-en-3-one → {[(4E)-5-(4-methoxyphenyl)-3-oxopent-4-en-2-yl]oxy}sulfonic acid details
(1E)-5-hydroxy-1-(4-methoxyphenyl)pent-1-en-3-one → {[(4E)-5-(4-methoxyphenyl)-3-oxopent-4-en-1-yl]oxy}sulfonic acid details
(1E)-1-(4-methoxyphenyl)pent-1-en-3-ol → {[(1E)-1-(4-methoxyphenyl)pent-1-en-3-yl]oxy}sulfonic acid details
4-hydroxy-1-(4-methoxyphenyl)pentan-3-one → {[5-(4-methoxyphenyl)-3-oxopentan-2-yl]oxy}sulfonic acid details
1-hydroxy-5-(4-methoxyphenyl)pentan-3-one → {[5-(4-methoxyphenyl)-3-oxopentyl]oxy}sulfonic acid details
2-hydroxy-1-(4-methoxyphenyl)pentan-3-one → {[1-(4-methoxyphenyl)-3-oxopentan-2-yl]oxy}sulfonic acid details
1-hydroxy-1-(4-methoxyphenyl)pentan-3-one → {[1-(4-methoxyphenyl)-3-oxopentyl]oxy}sulfonic acid details
1-(4-methoxyphenyl)pentan-3-ol → {[1-(4-methoxyphenyl)pentan-3-yl]oxy}sulfonic acid details
5-{[7-(1-hydroxy-2-methylbut-3-en-2-yl)-2,2-dimethyl-5-[(2-methylbut-3-en-2-yl)oxy]-8-oxo-2H,8H-pyrano[3,2-g]chromen-10-yl]oxy}-8,8-dimethyl-3,10-bis(2-methylbut-3-en-2-yl)-2H,8H-pyrano[3,2-g]chromen-2-one → {[2-(10-{[2,2-dimethyl-7,10-bis(2-methylbut-3-en-2-yl)-8-oxo-2H,8H-pyrano[3,2-g]chromen-5-yl]oxy}-8,8-dimethyl-5-[(2-methylbut-3-en-2-yl)oxy]-2-oxo-2H,8H-pyrano[3,2-g]chromen-3-yl)-2-methylbut-3-en-1-yl]oxy}sulfonic acid details
5-{[2,2-dimethyl-7-(2-methylbut-3-en-2-yl)-5-[(2-methylbut-3-en-2-yl)oxy]-8-oxo-2H,8H-pyrano[3,2-g]chromen-10-yl]oxy}-3-(1-hydroxy-2-methylbut-3-en-2-yl)-8,8-dimethyl-10-(2-methylbut-3-en-2-yl)-2H,8H-pyrano[3,2-g]chromen-2-one → {[2-(5-{[2,2-dimethyl-7-(2-methylbut-3-en-2-yl)-5-[(2-methylbut-3-en-2-yl)oxy]-8-oxo-2H,8H-pyrano[3,2-g]chromen-10-yl]oxy}-8,8-dimethyl-10-(2-methylbut-3-en-2-yl)-2-oxo-2H,8H-pyrano[3,2-g]chromen-3-yl)-2-methylbut-3-en-1-yl]oxy}sulfonic acid details
5-{[2,2-dimethyl-7-(2-methylbut-3-en-2-yl)-5-[(2-methylbut-3-en-2-yl)oxy]-8-oxo-2H,8H-pyrano[3,2-g]chromen-10-yl]oxy}-10-(1-hydroxy-2-methylbut-3-en-2-yl)-8,8-dimethyl-3-(2-methylbut-3-en-2-yl)-2H,8H-pyrano[3,2-g]chromen-2-one → {[2-(5-{[2,2-dimethyl-7-(2-methylbut-3-en-2-yl)-5-[(2-methylbut-3-en-2-yl)oxy]-8-oxo-2H,8H-pyrano[3,2-g]chromen-10-yl]oxy}-2,2-dimethyl-7-(2-methylbut-3-en-2-yl)-8-oxo-2H,8H-pyrano[3,2-g]chromen-10-yl)-2-methylbut-3-en-1-yl]oxy}sulfonic acid details
5-({5-[(1-hydroxy-2-methylbut-3-en-2-yl)oxy]-2,2-dimethyl-7-(2-methylbut-3-en-2-yl)-8-oxo-2H,8H-pyrano[3,2-g]chromen-10-yl}oxy)-8,8-dimethyl-3,10-bis(2-methylbut-3-en-2-yl)-2H,8H-pyrano[3,2-g]chromen-2-one → ({2-[(10-{[2,2-dimethyl-7,10-bis(2-methylbut-3-en-2-yl)-8-oxo-2H,8H-pyrano[3,2-g]chromen-5-yl]oxy}-2,2-dimethyl-7-(2-methylbut-3-en-2-yl)-8-oxo-2H,8H-pyrano[3,2-g]chromen-5-yl)oxy]-2-methylbut-3-en-1-yl}oxy)sulfonic acid details
5-{[2-(hydroxymethyl)-2-methyl-7-(2-methylbut-3-en-2-yl)-5-[(2-methylbut-3-en-2-yl)oxy]-8-oxo-2H,8H-pyrano[3,2-g]chromen-10-yl]oxy}-8,8-dimethyl-3,10-bis(2-methylbut-3-en-2-yl)-2H,8H-pyrano[3,2-g]chromen-2-one → [(10-{[2,2-dimethyl-7,10-bis(2-methylbut-3-en-2-yl)-8-oxo-2H,8H-pyrano[3,2-g]chromen-5-yl]oxy}-2-methyl-7-(2-methylbut-3-en-2-yl)-5-[(2-methylbut-3-en-2-yl)oxy]-8-oxo-2H,8H-pyrano[3,2-g]chromen-2-yl)methoxy]sulfonic acid details
10-{[2-(hydroxymethyl)-2-methyl-7,10-bis(2-methylbut-3-en-2-yl)-8-oxo-2H,8H-pyrano[3,2-g]chromen-5-yl]oxy}-8,8-dimethyl-3-(2-methylbut-3-en-2-yl)-5-[(2-methylbut-3-en-2-yl)oxy]-2H,8H-pyrano[3,2-g]chromen-2-one → [(5-{[2,2-dimethyl-7-(2-methylbut-3-en-2-yl)-5-[(2-methylbut-3-en-2-yl)oxy]-8-oxo-2H,8H-pyrano[3,2-g]chromen-10-yl]oxy}-2-methyl-7,10-bis(2-methylbut-3-en-2-yl)-8-oxo-2H,8H-pyrano[3,2-g]chromen-2-yl)methoxy]sulfonic acid details
(R)-Kanzonol Y → ({1-[2,4-dihydroxy-5-(3-methylbut-2-en-1-yl)phenyl]-3-[4-hydroxy-3-(3-methylbut-2-en-1-yl)phenyl]-1-oxopropan-2-yl}oxy)sulfonic acid details
2-hydroxy-3-[4-hydroxy-3-(3-methylbut-2-en-1-yl)phenyl]propanoic acid → 3-[4-hydroxy-3-(3-methylbut-2-en-1-yl)phenyl]-2-(sulfooxy)propanoic acid details
1-[2,4-dihydroxy-5-(3-methylbut-2-en-1-yl)phenyl]-2-hydroxy-3-[4-hydroxy-3-(4-hydroxy-3-methylbut-2-en-1-yl)phenyl]propan-1-one → {[4-(5-{3-[2,4-dihydroxy-5-(3-methylbut-2-en-1-yl)phenyl]-2-hydroxy-3-oxopropyl}-2-hydroxyphenyl)-2-methylbut-2-en-1-yl]oxy}sulfonic acid details
1-[2,4-dihydroxy-5-(3-methylbut-2-en-1-yl)phenyl]-2-hydroxy-3-[4-hydroxy-3-(4-hydroxy-3-methylbut-2-en-1-yl)phenyl]propan-1-one → ({1-[2,4-dihydroxy-5-(3-methylbut-2-en-1-yl)phenyl]-3-[4-hydroxy-3-(4-hydroxy-3-methylbut-2-en-1-yl)phenyl]-1-oxopropan-2-yl}oxy)sulfonic acid details
1-[2,4-dihydroxy-5-(4-hydroxy-3-methylbut-2-en-1-yl)phenyl]-2-hydroxy-3-[4-hydroxy-3-(3-methylbut-2-en-1-yl)phenyl]propan-1-one → {[4-(2,4-dihydroxy-5-{2-hydroxy-3-[4-hydroxy-3-(3-methylbut-2-en-1-yl)phenyl]propanoyl}phenyl)-2-methylbut-2-en-1-yl]oxy}sulfonic acid details
1-[2,4-dihydroxy-5-(4-hydroxy-3-methylbut-2-en-1-yl)phenyl]-2-hydroxy-3-[4-hydroxy-3-(3-methylbut-2-en-1-yl)phenyl]propan-1-one → ({1-[2,4-dihydroxy-5-(4-hydroxy-3-methylbut-2-en-1-yl)phenyl]-3-[4-hydroxy-3-(3-methylbut-2-en-1-yl)phenyl]-1-oxopropan-2-yl}oxy)sulfonic acid details
1-{2,4-dihydroxy-5-[(2E)-4-hydroxy-3-methylbut-2-en-1-yl]phenyl}-2-hydroxy-3-[4-hydroxy-3-(3-methylbut-2-en-1-yl)phenyl]propan-1-one → {[(2E)-4-(2,4-dihydroxy-5-{2-hydroxy-3-[4-hydroxy-3-(3-methylbut-2-en-1-yl)phenyl]propanoyl}phenyl)-2-methylbut-2-en-1-yl]oxy}sulfonic acid details
1-{2,4-dihydroxy-5-[(2E)-4-hydroxy-3-methylbut-2-en-1-yl]phenyl}-2-hydroxy-3-[4-hydroxy-3-(3-methylbut-2-en-1-yl)phenyl]propan-1-one → [(1-{2,4-dihydroxy-5-[(2E)-4-hydroxy-3-methylbut-2-en-1-yl]phenyl}-3-[4-hydroxy-3-(3-methylbut-2-en-1-yl)phenyl]-1-oxopropan-2-yl)oxy]sulfonic acid details
1-[2,4-dihydroxy-5-(3-methylbut-2-en-1-yl)phenyl]-2,3-dihydroxy-3-[4-hydroxy-3-(3-methylbut-2-en-1-yl)phenyl]propan-1-one → {3-[2,4-dihydroxy-5-(3-methylbut-2-en-1-yl)phenyl]-2-hydroxy-1-[4-hydroxy-3-(3-methylbut-2-en-1-yl)phenyl]-3-oxopropoxy}sulfonic acid details
1-[2,4-dihydroxy-5-(3-methylbut-2-en-1-yl)phenyl]-2,3-dihydroxy-3-[4-hydroxy-3-(3-methylbut-2-en-1-yl)phenyl]propan-1-one → ({1-[2,4-dihydroxy-5-(3-methylbut-2-en-1-yl)phenyl]-3-hydroxy-3-[4-hydroxy-3-(3-methylbut-2-en-1-yl)phenyl]-1-oxopropan-2-yl}oxy)sulfonic acid details
1-[2,4-dihydroxy-5-(3-methylbut-2-en-1-yl)phenyl]-3-{3-[(3,3-dimethyloxiran-2-yl)methyl]-4-hydroxyphenyl}-2-hydroxypropan-1-one → ({1-[2,4-dihydroxy-5-(3-methylbut-2-en-1-yl)phenyl]-3-{3-[(3,3-dimethyloxiran-2-yl)methyl]-4-hydroxyphenyl}-1-oxopropan-2-yl}oxy)sulfonic acid details
1-{5-[(3,3-dimethyloxiran-2-yl)methyl]-2,4-dihydroxyphenyl}-2-hydroxy-3-[4-hydroxy-3-(3-methylbut-2-en-1-yl)phenyl]propan-1-one → [(1-{5-[(3,3-dimethyloxiran-2-yl)methyl]-2,4-dihydroxyphenyl}-3-[4-hydroxy-3-(3-methylbut-2-en-1-yl)phenyl]-1-oxopropan-2-yl)oxy]sulfonic acid details
1-[2,4-dihydroxy-5-(3-methylbut-2-en-1-yl)phenyl]-3-[3,4-dihydroxy-5-(3-methylbut-2-en-1-yl)phenyl]-2-hydroxypropan-1-one → ({1-[2,4-dihydroxy-5-(3-methylbut-2-en-1-yl)phenyl]-3-[3,4-dihydroxy-5-(3-methylbut-2-en-1-yl)phenyl]-1-oxopropan-2-yl}oxy)sulfonic acid details
4-[(2E)-4-hydroxy-3-methylbut-2-en-1-yl]benzene-1,3-diol → {[(2E)-4-(2,4-dihydroxyphenyl)-2-methylbut-2-en-1-yl]oxy}sulfonic acid details
4-(4-hydroxy-3-methylbut-2-en-1-yl)benzene-1,3-diol → {[4-(2,4-dihydroxyphenyl)-2-methylbut-2-en-1-yl]oxy}sulfonic acid details
2-hydroxy-3-[4-hydroxy-3-(4-hydroxy-3-methylbut-2-en-1-yl)phenyl]propanoic acid → 2-hydroxy-3-{4-hydroxy-3-[3-methyl-4-(sulfooxy)but-2-en-1-yl]phenyl}propanoic acid details
2-hydroxy-3-[4-hydroxy-3-(4-hydroxy-3-methylbut-2-en-1-yl)phenyl]propanoic acid → 3-[4-hydroxy-3-(4-hydroxy-3-methylbut-2-en-1-yl)phenyl]-2-(sulfooxy)propanoic acid details
2,3-dihydroxy-3-[4-hydroxy-3-(3-methylbut-2-en-1-yl)phenyl]propanoic acid → 2-hydroxy-3-[4-hydroxy-3-(3-methylbut-2-en-1-yl)phenyl]-3-(sulfooxy)propanoic acid details
2,3-dihydroxy-3-[4-hydroxy-3-(3-methylbut-2-en-1-yl)phenyl]propanoic acid → 3-hydroxy-3-[4-hydroxy-3-(3-methylbut-2-en-1-yl)phenyl]-2-(sulfooxy)propanoic acid details
3-{3-[(3,3-dimethyloxiran-2-yl)methyl]-4-hydroxyphenyl}-2-hydroxypropanoic acid → 3-{3-[(3,3-dimethyloxiran-2-yl)methyl]-4-hydroxyphenyl}-2-(sulfooxy)propanoic acid details
3-[3,4-dihydroxy-5-(3-methylbut-2-en-1-yl)phenyl]-2-hydroxypropanoic acid → 3-[3,4-dihydroxy-5-(3-methylbut-2-en-1-yl)phenyl]-2-(sulfooxy)propanoic acid details
6,7,8,11,12,13,21,22,23-nonahydroxy-2,17,20-trioxatetracyclo[17.3.1.0⁴,⁹.0¹⁰,¹⁵]tricosa-4,6,8,10,12,14-hexaene-3,16-dione → {6,7,8,11,12,13,21,23-octahydroxy-3,16-dioxo-2,17,20-trioxatetracyclo[17.3.1.0⁴,⁹.0¹⁰,¹⁵]tricosa-4,6,8,10,12,14-hexaen-22-yl}oxidanesulfonic acid details
6,7,8,11,12,13,21,22,23-nonahydroxy-2,17,20-trioxatetracyclo[17.3.1.0⁴,⁹.0¹⁰,¹⁵]tricosa-4,6,8,10,12,14-hexaene-3,16-dione → {6,7,8,11,12,13,21,22-octahydroxy-3,16-dioxo-2,17,20-trioxatetracyclo[17.3.1.0⁴,⁹.0¹⁰,¹⁵]tricosa-4,6,8,10,12,14-hexaen-23-yl}oxidanesulfonic acid details
Hydroxygaleon → {4-hydroxy-17-methoxy-10-oxo-2-oxatricyclo[13.2.2.1³,⁷]icosa-1(17),3,5,7(20),15,18-hexaen-8-yl}oxidanesulfonic acid details
4,8,14-trihydroxy-17-methoxy-2-oxatricyclo[13.2.2.1³,⁷]icosa-1(17),3,5,7(20),15,18-hexaen-10-one → {4,8-dihydroxy-17-methoxy-10-oxo-2-oxatricyclo[13.2.2.1³,⁷]icosa-1(17),3,5,7(20),15,18-hexaen-14-yl}oxidanesulfonic acid details
4,8,14-trihydroxy-17-methoxy-2-oxatricyclo[13.2.2.1³,⁷]icosa-1(17),3,5,7(20),15,18-hexaen-10-one → {4,14-dihydroxy-17-methoxy-10-oxo-2-oxatricyclo[13.2.2.1³,⁷]icosa-1(17),3,5,7(20),15,18-hexaen-8-yl}oxidanesulfonic acid details
4,8,11-trihydroxy-17-methoxy-2-oxatricyclo[13.2.2.1³,⁷]icosa-1(17),3,5,7(20),15,18-hexaen-10-one → {4,8-dihydroxy-17-methoxy-10-oxo-2-oxatricyclo[13.2.2.1³,⁷]icosa-1(17),3,5,7(20),15,18-hexaen-11-yl}oxidanesulfonic acid details
4,8,11-trihydroxy-17-methoxy-2-oxatricyclo[13.2.2.1³,⁷]icosa-1(17),3,5,7(20),15,18-hexaen-10-one → {4,11-dihydroxy-17-methoxy-10-oxo-2-oxatricyclo[13.2.2.1³,⁷]icosa-1(17),3,5,7(20),15,18-hexaen-8-yl}oxidanesulfonic acid details
4,8,9-trihydroxy-17-methoxy-2-oxatricyclo[13.2.2.1³,⁷]icosa-1(17),3,5,7(20),15,18-hexaen-10-one → {4,8-dihydroxy-17-methoxy-10-oxo-2-oxatricyclo[13.2.2.1³,⁷]icosa-1(17),3,5,7(20),15,18-hexaen-9-yl}oxidanesulfonic acid details
4,8,9-trihydroxy-17-methoxy-2-oxatricyclo[13.2.2.1³,⁷]icosa-1(17),3,5,7(20),15,18-hexaen-10-one → {4,9-dihydroxy-17-methoxy-10-oxo-2-oxatricyclo[13.2.2.1³,⁷]icosa-1(17),3,5,7(20),15,18-hexaen-8-yl}oxidanesulfonic acid details
2,4,6-trihydroxy-2-[hydroxy(4-hydroxyphenyl)methyl]-2,3-dihydro-1-benzofuran-3-one → [(4-hydroxyphenyl)(2,4,6-trihydroxy-3-oxo-2,3-dihydro-1-benzofuran-2-yl)methoxy]sulfonic acid details
2-[(4-hydroxyphenyl)methyl]-2,3-dihydro-1-benzofuran-2,3,4,6-tetrol → {2,4,6-trihydroxy-2-[(4-hydroxyphenyl)methyl]-2,3-dihydro-1-benzofuran-3-yl}oxidanesulfonic acid details
2,4,6-trihydroxy-2-[hydroxy(phenyl)methyl]-2,3-dihydro-1-benzofuran-3-one → [phenyl(2,4,6-trihydroxy-3-oxo-2,3-dihydro-1-benzofuran-2-yl)methoxy]sulfonic acid details
2-benzyl-2,3-dihydro-1-benzofuran-2,3,4,6-tetrol → (2-benzyl-2,4,6-trihydroxy-2,3-dihydro-1-benzofuran-3-yl)oxidanesulfonic acid details
(2E)-2-methyl-3-phenylprop-2-en-1-ol → {[(2E)-2-methyl-3-phenylprop-2-en-1-yl]oxy}sulfonic acid details
(2Z)-2-(hydroxymethyl)-3-phenylprop-2-enal → [(2Z)-3-oxo-2-(phenylmethylidene)propoxy]sulfonic acid details
2-benzyl-3-hydroxypropanal → (2-benzyl-3-oxopropoxy)sulfonic acid details
3-hydroxy-2-methyl-3-phenylpropanal → (2-methyl-3-oxo-1-phenylpropoxy)sulfonic acid details
2-(phenylmethylidene)propane-1,3-diol → [(2E)-3-hydroxy-2-(phenylmethylidene)propoxy]sulfonic acid details
3-[(1E)-3-hydroxy-2-methylprop-1-en-1-yl]phenol → {[(2E)-3-(3-hydroxyphenyl)-2-methylprop-2-en-1-yl]oxy}sulfonic acid details
4-[(1E)-3-hydroxy-2-methylprop-1-en-1-yl]phenol → {[(2E)-3-(4-hydroxyphenyl)-2-methylprop-2-en-1-yl]oxy}sulfonic acid details
(2-methyl-3-phenyloxiran-2-yl)methanol → [(2-methyl-3-phenyloxiran-2-yl)methoxy]sulfonic acid details
2-[(1E)-3-hydroxy-2-methylprop-1-en-1-yl]phenol → {[(2E)-3-(2-hydroxyphenyl)-2-methylprop-2-en-1-yl]oxy}sulfonic acid details
(2Z)-2-(hydroxymethyl)-3-phenylprop-2-enoic acid → (2Z)-3-phenyl-2-[(sulfooxy)methyl]prop-2-enoic acid details
2-methyl-3-phenylpropan-1-ol → (2-methyl-3-phenylpropoxy)sulfonic acid details
1-hydroxy-3-methyl-4-phenylbut-3-en-2-one → [(3-methyl-2-oxo-4-phenylbut-3-en-1-yl)oxy]sulfonic acid details
3-(hydroxymethyl)-4-phenylbut-3-en-2-one → [3-oxo-2-(phenylmethylidene)butoxy]sulfonic acid details
4-hydroxy-3-methyl-4-phenylbutan-2-one → (2-methyl-3-oxo-1-phenylbutoxy)sulfonic acid details
3-benzyl-4-hydroxybutan-2-one → (2-benzyl-3-oxobutoxy)sulfonic acid details
1-hydroxy-3-methyl-4-phenylbutan-2-one → (3-methyl-2-oxo-4-phenylbutoxy)sulfonic acid details
Myricatomentoside II → (3-hydroxy-16,17-dimethoxy-9-oxo-15-{[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxy}tricyclo[12.3.1.1²,⁶]nonadeca-1(17),2,4,6(19),14(18),15-hexaen-8-yl)oxidanesulfonic acid details
3,7,8,15-tetrahydroxy-16,17-dimethoxytricyclo[12.3.1.1²,⁶]nonadeca-1(17),2,4,6(19),14(18),15-hexaen-9-one → {3,8,15-trihydroxy-16,17-dimethoxy-9-oxotricyclo[12.3.1.1²,⁶]nonadeca-1(17),2,4,6(19),14(18),15-hexaen-7-yl}oxidanesulfonic acid details
3,7,8,15-tetrahydroxy-16,17-dimethoxytricyclo[12.3.1.1²,⁶]nonadeca-1(17),2,4,6(19),14(18),15-hexaen-9-one → {3,7,15-trihydroxy-16,17-dimethoxy-9-oxotricyclo[12.3.1.1²,⁶]nonadeca-1(17),2,4,6(19),14(18),15-hexaen-8-yl}oxidanesulfonic acid details
(3E)-4-phenylbut-3-ene-1,2-diol → {[(3E)-2-hydroxy-4-phenylbut-3-en-1-yl]oxy}sulfonic acid details
(3E)-4-phenylbut-3-ene-1,2-diol → {[(3E)-1-hydroxy-4-phenylbut-3-en-2-yl]oxy}sulfonic acid details
3-[(1E)-3-hydroxybut-1-en-1-yl]phenol → {[(3E)-4-(3-hydroxyphenyl)but-3-en-2-yl]oxy}sulfonic acid details
4-[(1E)-3-hydroxybut-1-en-1-yl]phenol → {[(3E)-4-(4-hydroxyphenyl)but-3-en-2-yl]oxy}sulfonic acid details
1-(3-phenyloxiran-2-yl)ethan-1-ol → [1-(3-phenyloxiran-2-yl)ethoxy]sulfonic acid details
(3E)-1-hydroxy-4-phenylbut-3-en-2-one → {[(3E)-2-oxo-4-phenylbut-3-en-1-yl]oxy}sulfonic acid details
3-Hydroxy-4-phenylbutan-2-one → [(3-oxo-1-phenylbutan-2-yl)oxy]sulfonic acid details
1-hydroxy-4-phenylbutan-2-one → (2-oxo-4-phenylbutoxy)sulfonic acid details
4-hydroxy-4-phenylbutan-2-one → (3-oxo-1-phenylbutoxy)sulfonic acid details
4-(4-hydroxy-3-methylbut-2-en-1-yl)-5-methoxy-8,17-dioxatetracyclo[8.7.0.0²,⁷.0¹¹,¹⁶]heptadeca-2(7),3,5,11(16),12,14-hexaen-14-ol → [(4-{14-hydroxy-5-methoxy-8,17-dioxatetracyclo[8.7.0.0²,⁷.0¹¹,¹⁶]heptadeca-2(7),3,5,11(16),12,14-hexaen-4-yl}-2-methylbut-2-en-1-yl)oxy]sulfonic acid details
3-(2-hydroxy-4-methoxyphenyl)-3,4-dihydro-2H-1-benzopyran-4,5,7-triol → [5,7-dihydroxy-3-(2-hydroxy-4-methoxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-yl]oxidanesulfonic acid details
(6E)-1-hydroxy-1,7-diphenylhepta-4,6-dien-3-one → {[(6E)-3-oxo-1,7-diphenylhepta-4,6-dien-1-yl]oxy}sulfonic acid details
(6E)-2-hydroxy-1,7-diphenylhepta-4,6-dien-3-one → {[(6E)-3-oxo-1,7-diphenylhepta-4,6-dien-2-yl]oxy}sulfonic acid details
(6E)-5-hydroxy-1,7-diphenylhept-6-en-3-one → {[(1E)-5-oxo-1,7-diphenylhept-1-en-3-yl]oxy}sulfonic acid details
(6E)-1-hydroxy-1,7-diphenylhept-6-en-3-one → {[(6E)-3-oxo-1,7-diphenylhept-6-en-1-yl]oxy}sulfonic acid details
(6E)-4-hydroxy-1,7-diphenylhept-6-en-3-one → {[(1E)-5-oxo-1,7-diphenylhept-1-en-4-yl]oxy}sulfonic acid details
(6E)-2-hydroxy-1,7-diphenylhept-6-en-3-one → {[(6E)-3-oxo-1,7-diphenylhept-6-en-2-yl]oxy}sulfonic acid details
2-(3-hydroxyprop-1-en-1-yl)phenol → {[3-(2-hydroxyphenyl)prop-2-en-1-yl]oxy}sulfonic acid details
2-hydroxy-3-(2-hydroxyphenyl)propanal → {[1-(2-hydroxyphenyl)-3-oxopropan-2-yl]oxy}sulfonic acid details
3-hydroxy-3-(2-hydroxyphenyl)propanal → [1-(2-hydroxyphenyl)-3-oxopropoxy]sulfonic acid details
3-(3-hydroxyprop-1-en-1-yl)benzene-1,2-diol → {[3-(2,3-dihydroxyphenyl)prop-2-en-1-yl]oxy}sulfonic acid details
2-[3-(hydroxymethyl)oxiran-2-yl]phenol → {[3-(2-hydroxyphenyl)oxiran-2-yl]methoxy}sulfonic acid details
2-(3-hydroxyprop-1-en-1-yl)benzene-1,4-diol → {[3-(2,5-dihydroxyphenyl)prop-2-en-1-yl]oxy}sulfonic acid details
(4E)-6-hydroxy-1,7-diphenylhept-4-en-3-one → {[(3E)-5-oxo-1,7-diphenylhept-3-en-2-yl]oxy}sulfonic acid details
7-hydroxy-1,7-diphenylhept-4-en-3-one → [(5-oxo-1,7-diphenylhept-3-en-1-yl)oxy]sulfonic acid details
1-hydroxy-1,7-diphenylhept-4-en-3-one → [(3-oxo-1,7-diphenylhept-4-en-1-yl)oxy]sulfonic acid details
2-hydroxy-1,7-diphenylhept-4-en-3-one → [(3-oxo-1,7-diphenylhept-4-en-2-yl)oxy]sulfonic acid details
6-hydroxy-1,7-diphenylheptan-3-one → [(5-oxo-1,7-diphenylheptan-2-yl)oxy]sulfonic acid details
5-hydroxy-1,7-diphenylheptan-3-one → [(5-oxo-1,7-diphenylheptan-3-yl)oxy]sulfonic acid details
4-hydroxy-1,7-diphenylheptan-3-one → [(3-oxo-1,7-diphenylheptan-4-yl)oxy]sulfonic acid details
2-hydroxy-1,7-diphenylheptan-3-one → [(3-oxo-1,7-diphenylheptan-2-yl)oxy]sulfonic acid details
7-hydroxy-1,7-diphenylheptan-3-one → [(5-oxo-1,7-diphenylheptyl)oxy]sulfonic acid details
1-hydroxy-1,7-diphenylheptan-3-one → [(3-oxo-1,7-diphenylheptyl)oxy]sulfonic acid details
2-[7,8,9,12,13,14,17,18,19,25-decahydroxy-24-(hydroxymethyl)-4,22,27-trioxo-3,23,26-trioxahexacyclo[13.10.3.1²,⁶.0⁵,¹⁰.0¹¹,²⁸.0¹⁶,²¹]nonacosa-5(10),6,8,11,13,15(28),16,18,20-nonaen-29-yl]-3,4,5-trihydroxybenzoic acid → 2-{7,8,9,12,13,14,17,18,19,25-decahydroxy-4,22,27-trioxo-24-[(sulfooxy)methyl]-3,23,26-trioxahexacyclo[13.10.3.1²,⁶.0⁵,¹⁰.0¹¹,²⁸.0¹⁶,²¹]nonacosa-5(10),6,8,11,13,15(28),16,18,20-nonaen-29-yl}-3,4,5-trihydroxybenzoic acid details
2-[7,8,9,12,13,14,17,18,19,25-decahydroxy-24-(hydroxymethyl)-4,22,27-trioxo-3,23,26-trioxahexacyclo[13.10.3.1²,⁶.0⁵,¹⁰.0¹¹,²⁸.0¹⁶,²¹]nonacosa-5(10),6,8,11,13,15(28),16,18,20-nonaen-29-yl]-3,4,5-trihydroxybenzoic acid → 3,4,5-trihydroxy-2-[7,8,9,12,13,14,17,18,19-nonahydroxy-24-(hydroxymethyl)-4,22,27-trioxo-25-(sulfooxy)-3,23,26-trioxahexacyclo[13.10.3.1²,⁶.0⁵,¹⁰.0¹¹,²⁸.0¹⁶,²¹]nonacosa-5(10),6,8,11,13,15(28),16,18,20-nonaen-29-yl]benzoic acid details
4-[(2E)-1-hydroxy-3-(4-hydroxyphenyl)prop-2-en-1-yl]benzene-1,2,3,5-tetrol → {[(2E)-3-(4-hydroxyphenyl)-1-(2,3,4,6-tetrahydroxyphenyl)prop-2-en-1-yl]oxy}sulfonic acid details
Xanthotoxol arabinoside → [3,5-dihydroxy-2-({7-oxo-7H-furo[3,2-g]chromen-9-yl}oxy)oxan-4-yl]oxidanesulfonic acid details
Xanthotoxol arabinoside → [4,5-dihydroxy-2-({7-oxo-7H-furo[3,2-g]chromen-9-yl}oxy)oxan-3-yl]oxidanesulfonic acid details
Xanthotoxol arabinoside → [4,5-dihydroxy-6-({7-oxo-7H-furo[3,2-g]chromen-9-yl}oxy)oxan-3-yl]oxidanesulfonic acid details
3-{4-[(3-{[3,4-dihydroxy-4-(hydroxymethyl)oxolan-2-yl]oxy}-4,5-dihydroxy-6-(hydroxymethyl)oxan-2-yl)oxy]phenyl}-1-(2,4-dihydroxyphenyl)prop-2-en-1-one → ({5-[(2-{4-[3-(2,4-dihydroxyphenyl)-3-oxoprop-1-en-1-yl]phenoxy}-4,5-dihydroxy-6-(hydroxymethyl)oxan-3-yl)oxy]-3,4-dihydroxyoxolan-3-yl}methoxy)sulfonic acid details
3-{4-[(3-{[3,4-dihydroxy-4-(hydroxymethyl)oxolan-2-yl]oxy}-4,5-dihydroxy-6-(hydroxymethyl)oxan-2-yl)oxy]phenyl}-1-(2,4-dihydroxyphenyl)prop-2-en-1-one → {2-[(2-{4-[3-(2,4-dihydroxyphenyl)-3-oxoprop-1-en-1-yl]phenoxy}-4,5-dihydroxy-6-(hydroxymethyl)oxan-3-yl)oxy]-4-hydroxy-4-(hydroxymethyl)oxolan-3-yl}oxidanesulfonic acid details
4-(4-hydroxy-3-methylbut-2-en-1-yl)-3-methoxy-8,17-dioxatetracyclo[8.7.0.0²,⁷.0¹¹,¹⁶]heptadeca-1(10),2(7),3,5,11(16),12,14-heptaene-5,14-diol → [(4-{5,14-dihydroxy-3-methoxy-8,17-dioxatetracyclo[8.7.0.0²,⁷.0¹¹,¹⁶]heptadeca-1(10),2(7),3,5,11(16),12,14-heptaen-4-yl}-2-methylbut-2-en-1-yl)oxy]sulfonic acid details
Liquiritin apioside → {[5-({4,5-dihydroxy-2-[4-(7-hydroxy-4-oxo-3,4-dihydro-2H-1-benzopyran-2-yl)phenoxy]-6-(hydroxymethyl)oxan-3-yl}oxy)-3,4-dihydroxyoxolan-3-yl]methoxy}sulfonic acid details
Liquiritin apioside → [2-({4,5-dihydroxy-2-[4-(7-hydroxy-4-oxo-3,4-dihydro-2H-1-benzopyran-2-yl)phenoxy]-6-(hydroxymethyl)oxan-3-yl}oxy)-4-hydroxy-4-(hydroxymethyl)oxolan-3-yl]oxidanesulfonic acid details
Licorice glycoside E → [2-({4,5-dihydroxy-2-[4-(7-hydroxy-4-oxo-3,4-dihydro-2H-1-benzopyran-2-yl)phenoxy]-6-(hydroxymethyl)oxan-3-yl}oxy)-4-hydroxy-4-[(1H-indole-3-carbonyloxy)methyl]oxolan-3-yl]oxidanesulfonic acid details
Epifisetinidol-(4beta->8)-epicatechin-(6->4beta)-epifisetinidol → [2-(3,4-dihydroxyphenyl)-4-[2-(3,4-dihydroxyphenyl)-6-[2-(3,4-dihydroxyphenyl)-3,7-dihydroxy-3,4-dihydro-2H-1-benzopyran-4-yl]-3,5,7-trihydroxy-3,4-dihydro-2H-1-benzopyran-8-yl]-7-hydroxy-3,4-dihydro-2H-1-benzopyran-3-yl]oxidanesulfonic acid details
Epifisetinidol-(4beta->8)-epicatechin-(6->4beta)-epifisetinidol → [2-(3,4-dihydroxyphenyl)-4-[2-(3,4-dihydroxyphenyl)-8-[2-(3,4-dihydroxyphenyl)-3,7-dihydroxy-3,4-dihydro-2H-1-benzopyran-4-yl]-3,5,7-trihydroxy-3,4-dihydro-2H-1-benzopyran-6-yl]-7-hydroxy-3,4-dihydro-2H-1-benzopyran-3-yl]oxidanesulfonic acid details
6,8-bis[2-(3,4-dihydroxyphenyl)-3,7-dihydroxy-3,4-dihydro-2H-1-benzopyran-4-yl]-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-3,5,7-triol → [2-(3,4-dihydroxyphenyl)-4-{6-[2-(3,4-dihydroxyphenyl)-3,7-dihydroxy-3,4-dihydro-2H-1-benzopyran-4-yl]-3,5,7-trihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-8-yl}-7-hydroxy-3,4-dihydro-2H-1-benzopyran-3-yl]oxidanesulfonic acid details
6,8-bis[2-(3,4-dihydroxyphenyl)-3,7-dihydroxy-3,4-dihydro-2H-1-benzopyran-4-yl]-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-3,5,7-triol → [2-(3,4-dihydroxyphenyl)-4-{8-[2-(3,4-dihydroxyphenyl)-3,7-dihydroxy-3,4-dihydro-2H-1-benzopyran-4-yl]-3,5,7-trihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-6-yl}-7-hydroxy-3,4-dihydro-2H-1-benzopyran-3-yl]oxidanesulfonic acid details
8-[3,7-dihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-yl]-2-(3,4-dihydroxyphenyl)-6-[2-(3,4-dihydroxyphenyl)-3,7-dihydroxy-3,4-dihydro-2H-1-benzopyran-4-yl]-3,4-dihydro-2H-1-benzopyran-3,5,7-triol → {4-[2-(3,4-dihydroxyphenyl)-6-[2-(3,4-dihydroxyphenyl)-3,7-dihydroxy-3,4-dihydro-2H-1-benzopyran-4-yl]-3,5,7-trihydroxy-3,4-dihydro-2H-1-benzopyran-8-yl]-7-hydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-3-yl}oxidanesulfonic acid details
8-[3,7-dihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-yl]-2-(3,4-dihydroxyphenyl)-6-[2-(3,4-dihydroxyphenyl)-3,7-dihydroxy-3,4-dihydro-2H-1-benzopyran-4-yl]-3,4-dihydro-2H-1-benzopyran-3,5,7-triol → (4-{8-[3,7-dihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-yl]-2-(3,4-dihydroxyphenyl)-3,5,7-trihydroxy-3,4-dihydro-2H-1-benzopyran-6-yl}-2-(3,4-dihydroxyphenyl)-7-hydroxy-3,4-dihydro-2H-1-benzopyran-3-yl)oxidanesulfonic acid details
6-[3,7-dihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-yl]-2-(3,4-dihydroxyphenyl)-8-[2-(3,4-dihydroxyphenyl)-3,7-dihydroxy-3,4-dihydro-2H-1-benzopyran-4-yl]-3,4-dihydro-2H-1-benzopyran-3,5,7-triol → (4-{6-[3,7-dihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-yl]-2-(3,4-dihydroxyphenyl)-3,5,7-trihydroxy-3,4-dihydro-2H-1-benzopyran-8-yl}-2-(3,4-dihydroxyphenyl)-7-hydroxy-3,4-dihydro-2H-1-benzopyran-3-yl)oxidanesulfonic acid details
6-[3,7-dihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-yl]-2-(3,4-dihydroxyphenyl)-8-[2-(3,4-dihydroxyphenyl)-3,7-dihydroxy-3,4-dihydro-2H-1-benzopyran-4-yl]-3,4-dihydro-2H-1-benzopyran-3,5,7-triol → {4-[2-(3,4-dihydroxyphenyl)-8-[2-(3,4-dihydroxyphenyl)-3,7-dihydroxy-3,4-dihydro-2H-1-benzopyran-4-yl]-3,5,7-trihydroxy-3,4-dihydro-2H-1-benzopyran-6-yl]-7-hydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-3-yl}oxidanesulfonic acid details
8-[3,7-dihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-yl]-6-[2-(3,4-dihydroxyphenyl)-3,7-dihydroxy-3,4-dihydro-2H-1-benzopyran-4-yl]-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-3,5,7-triol → (4-{6-[2-(3,4-dihydroxyphenyl)-3,7-dihydroxy-3,4-dihydro-2H-1-benzopyran-4-yl]-3,5,7-trihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-8-yl}-7-hydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-3-yl)oxidanesulfonic acid details
8-[3,7-dihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-yl]-6-[2-(3,4-dihydroxyphenyl)-3,7-dihydroxy-3,4-dihydro-2H-1-benzopyran-4-yl]-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-3,5,7-triol → (4-{8-[3,7-dihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-yl]-3,5,7-trihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-6-yl}-2-(3,4-dihydroxyphenyl)-7-hydroxy-3,4-dihydro-2H-1-benzopyran-3-yl)oxidanesulfonic acid details
6-[3,7-dihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-yl]-8-[2-(3,4-dihydroxyphenyl)-3,7-dihydroxy-3,4-dihydro-2H-1-benzopyran-4-yl]-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-3,5,7-triol → (4-{6-[3,7-dihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-yl]-3,5,7-trihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-8-yl}-2-(3,4-dihydroxyphenyl)-7-hydroxy-3,4-dihydro-2H-1-benzopyran-3-yl)oxidanesulfonic acid details
6-[3,7-dihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-yl]-8-[2-(3,4-dihydroxyphenyl)-3,7-dihydroxy-3,4-dihydro-2H-1-benzopyran-4-yl]-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-3,5,7-triol → (4-{8-[2-(3,4-dihydroxyphenyl)-3,7-dihydroxy-3,4-dihydro-2H-1-benzopyran-4-yl]-3,5,7-trihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-6-yl}-7-hydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-3-yl)oxidanesulfonic acid details
6,8-bis[3,7-dihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-yl]-2-(3,4-dihydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-3,5,7-triol → (4-{6-[3,7-dihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-yl]-2-(3,4-dihydroxyphenyl)-3,5,7-trihydroxy-3,4-dihydro-2H-1-benzopyran-8-yl}-7-hydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-3-yl)oxidanesulfonic acid details
6,8-bis[3,7-dihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-yl]-2-(3,4-dihydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-3,5,7-triol → (4-{8-[3,7-dihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-yl]-2-(3,4-dihydroxyphenyl)-3,5,7-trihydroxy-3,4-dihydro-2H-1-benzopyran-6-yl}-7-hydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-3-yl)oxidanesulfonic acid details
6,8-bis[3,7-dihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-yl]-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-3,5,7-triol → (4-{6-[3,7-dihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-yl]-3,5,7-trihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-8-yl}-7-hydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-3-yl)oxidanesulfonic acid details
6,8-bis[3,7-dihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-yl]-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-3,5,7-triol → (4-{8-[3,7-dihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-yl]-3,5,7-trihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-6-yl}-7-hydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-3-yl)oxidanesulfonic acid details
Epifisetinidol-(4beta->8)-catechin → [2-(3,4-dihydroxyphenyl)-4-[2-(3,4-dihydroxyphenyl)-3,5,7-trihydroxy-3,4-dihydro-2H-1-benzopyran-8-yl]-7-hydroxy-3,4-dihydro-2H-1-benzopyran-3-yl]oxidanesulfonic acid details
2-(3,4-dihydroxyphenyl)-8-[1-(2,4-dihydroxyphenyl)-3-(3,4-dihydroxyphenyl)-2-hydroxypropyl]-3,4-dihydro-2H-1-benzopyran-3,5,7-triol → {[1-(2,4-dihydroxyphenyl)-3-(3,4-dihydroxyphenyl)-1-[2-(3,4-dihydroxyphenyl)-3,5,7-trihydroxy-3,4-dihydro-2H-1-benzopyran-8-yl]propan-2-yl]oxy}sulfonic acid details
8-[3,7-dihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-yl]-2-(3,4-dihydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-3,5,7-triol → {4-[2-(3,4-dihydroxyphenyl)-3,5,7-trihydroxy-3,4-dihydro-2H-1-benzopyran-8-yl]-7-hydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-3-yl}oxidanesulfonic acid details
8-[2-(3,4-dihydroxyphenyl)-3,7-dihydroxy-3,4-dihydro-2H-1-benzopyran-4-yl]-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-3,5,7-triol → [2-(3,4-dihydroxyphenyl)-7-hydroxy-4-[3,5,7-trihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-8-yl]-3,4-dihydro-2H-1-benzopyran-3-yl]oxidanesulfonic acid details
2-(3,4-dihydroxyphenyl)-8-[1-(2,4-dihydroxyphenyl)-2-hydroxy-3-(3-hydroxyphenyl)propyl]-3,4-dihydro-2H-1-benzopyran-3,5,7-triol → {[1-(2,4-dihydroxyphenyl)-1-[2-(3,4-dihydroxyphenyl)-3,5,7-trihydroxy-3,4-dihydro-2H-1-benzopyran-8-yl]-3-(3-hydroxyphenyl)propan-2-yl]oxy}sulfonic acid details
8-[1-(2,4-dihydroxyphenyl)-3-(3,4-dihydroxyphenyl)-2-hydroxypropyl]-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-3,5,7-triol → {[1-(2,4-dihydroxyphenyl)-3-(3,4-dihydroxyphenyl)-1-[3,5,7-trihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-8-yl]propan-2-yl]oxy}sulfonic acid details
2-[3-(3,4-dihydroxyphenyl)-2-hydroxypropyl]benzene-1,3,5-triol → {[1-(3,4-dihydroxyphenyl)-3-(2,4,6-trihydroxyphenyl)propan-2-yl]oxy}sulfonic acid details
8-[3,7-dihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-yl]-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-3,5,7-triol → [7-hydroxy-2-(3-hydroxyphenyl)-4-[3,5,7-trihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-8-yl]-3,4-dihydro-2H-1-benzopyran-3-yl]oxidanesulfonic acid details
8-[1-(2,4-dihydroxyphenyl)-2-hydroxy-3-(3-hydroxyphenyl)propyl]-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-3,5,7-triol → {[1-(2,4-dihydroxyphenyl)-3-(3-hydroxyphenyl)-1-[3,5,7-trihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-8-yl]propan-2-yl]oxy}sulfonic acid details
4-Hydroxy-(3',4'-dihydroxyphenyl)-valeric acid → 5-(3,4-dihydroxyphenyl)-4-(sulfooxy)pentanoic acid details
2-[2-hydroxy-3-(3-hydroxyphenyl)propyl]benzene-1,3,5-triol → {[1-(3-hydroxyphenyl)-3-(2,4,6-trihydroxyphenyl)propan-2-yl]oxy}sulfonic acid details
Benzoin → (2-oxo-1,2-diphenylethoxy)sulfonic acid details
2-hydroxy-2-(2-hydroxyphenyl)-1-phenylethan-1-one → [1-(2-hydroxyphenyl)-2-oxo-2-phenylethoxy]sulfonic acid details
2-hydroxy-1-(2-hydroxyphenyl)-2-phenylethan-1-one → [2-(2-hydroxyphenyl)-2-oxo-1-phenylethoxy]sulfonic acid details
2-hydroxy-1-(4-hydroxyphenyl)-2-phenylethan-1-one → [2-(4-hydroxyphenyl)-2-oxo-1-phenylethoxy]sulfonic acid details
2-hydroxy-2-(4-hydroxyphenyl)-1-phenylethan-1-one → [1-(4-hydroxyphenyl)-2-oxo-2-phenylethoxy]sulfonic acid details
1,2-diphenylethane-1,2-diol → (2-hydroxy-1,2-diphenylethoxy)sulfonic acid details
2-hydroxy-2-(3-hydroxyphenyl)-1-phenylethan-1-one → [1-(3-hydroxyphenyl)-2-oxo-2-phenylethoxy]sulfonic acid details
2-hydroxy-1-(3-hydroxyphenyl)-2-phenylethan-1-one → [2-(3-hydroxyphenyl)-2-oxo-1-phenylethoxy]sulfonic acid details
3-hydroxy-1,3-diphenylpropan-1-one → (3-oxo-1,3-diphenylpropoxy)sulfonic acid details
1,3-diphenylpropan-1-ol → (1,3-diphenylpropoxy)sulfonic acid details
trans-Cinnamyl alcohol → {[(2E)-3-phenylprop-2-en-1-yl]oxy}sulfonic acid details
2-hydroxy-3-phenylpropanal → [(1-oxo-3-phenylpropan-2-yl)oxy]sulfonic acid details
3-hydroxy-3-phenylpropanal → (3-oxo-1-phenylpropoxy)sulfonic acid details
3-[(1E)-3-hydroxyprop-1-en-1-yl]phenol → {[(2E)-3-(3-hydroxyphenyl)prop-2-en-1-yl]oxy}sulfonic acid details
4-Coumaryl alcohol → {[(2E)-3-(4-hydroxyphenyl)prop-2-en-1-yl]oxy}sulfonic acid details
(3-phenyloxiran-2-yl)methanol → [(3-phenyloxiran-2-yl)methoxy]sulfonic acid details
3-Phenyl-1-propanol → (3-phenylpropoxy)sulfonic acid details
12-[6,11-dihydroxy-2-(hydroxymethyl)-2,5-dimethyl-10-oxo-3,4,5,10-tetrahydro-2H-1-oxa-5-azatetraphen-4-yl]-6,11-dihydroxy-2,2,5-trimethyl-5,10-dihydro-2H-1-oxa-5-azatetraphen-10-one → {[4-(6,11-dihydroxy-2,2,5-trimethyl-10-oxo-5,10-dihydro-2H-1-oxa-5-azatetraphen-12-yl)-6,11-dihydroxy-2,5-dimethyl-10-oxo-3,4,5,10-tetrahydro-2H-1-oxa-5-azatetraphen-2-yl]methoxy}sulfonic acid details
12-(6,11-dihydroxy-2,2,5-trimethyl-10-oxo-3,4,5,10-tetrahydro-2H-1-oxa-5-azatetraphen-4-yl)-6,11-dihydroxy-2-(hydroxymethyl)-2,5-dimethyl-5,10-dihydro-2H-1-oxa-5-azatetraphen-10-one → {[12-(6,11-dihydroxy-2,2,5-trimethyl-10-oxo-3,4,5,10-tetrahydro-2H-1-oxa-5-azatetraphen-4-yl)-6,11-dihydroxy-2,5-dimethyl-10-oxo-5,10-dihydro-2H-1-oxa-5-azatetraphen-2-yl]methoxy}sulfonic acid details
1-(2,5-dihydroxyphenyl)-3-hydroxy-3-phenylpropan-1-one → [3-(2,5-dihydroxyphenyl)-3-oxo-1-phenylpropoxy]sulfonic acid details
2-(1-hydroxy-3-phenylpropyl)benzene-1,4-diol → [1-(2,5-dihydroxyphenyl)-3-phenylpropoxy]sulfonic acid details
1-(3,4-dihydroxyphenyl)-3-hydroxy-3-phenylpropan-1-one → [3-(3,4-dihydroxyphenyl)-3-oxo-1-phenylpropoxy]sulfonic acid details
3-hydroxy-1-(3-hydroxyphenyl)-3-phenylpropan-1-one → [3-(3-hydroxyphenyl)-3-oxo-1-phenylpropoxy]sulfonic acid details
3-(3,4-dimethoxyphenyl)-N-[2-(3,4-dimethoxyphenyl)-2-hydroxyethyl]prop-2-enimidic acid → 3-(3,4-dimethoxyphenyl)-N-[2-(3,4-dimethoxyphenyl)-2-(sulfooxy)ethyl]prop-2-enimidic acid details
3-(3,4-dimethoxyphenyl)-N-[2-(3,4-dimethoxyphenyl)ethyl]-3-hydroxypropanimidic acid → 3-(3,4-dimethoxyphenyl)-N-[2-(3,4-dimethoxyphenyl)ethyl]-3-(sulfooxy)propanimidic acid details
3-(3,4-dimethoxyphenyl)-N-[2-(3,4-dimethoxyphenyl)-2-hydroxyethyl]propanimidic acid → 3-(3,4-dimethoxyphenyl)-N-[2-(3,4-dimethoxyphenyl)-2-(sulfooxy)ethyl]propanimidic acid details
3-(3,4-dimethoxyphenyl)-N-[2-(3,4-dimethoxyphenyl)ethyl]-2-hydroxypropanimidic acid → 3-(3,4-dimethoxyphenyl)-N-[2-(3,4-dimethoxyphenyl)ethyl]-2-(sulfooxy)propanimidic acid details
2-phenyl-3,4-dihydro-2H-1-benzopyran-3,4,5,7-tetrol → (3,5,7-trihydroxy-2-phenyl-3,4-dihydro-2H-1-benzopyran-4-yl)oxidanesulfonic acid details
2-phenyl-3,4-dihydro-2H-1-benzopyran-3,4,5,7-tetrol → (4,5,7-trihydroxy-2-phenyl-3,4-dihydro-2H-1-benzopyran-3-yl)oxidanesulfonic acid details
6-(hydroxymethyl)-2H-chromen-2-one → [(2-oxo-2H-chromen-6-yl)methoxy]sulfonic acid details
1-hydroxy-1,3-diphenylpropan-2-one → (2-oxo-1,3-diphenylpropoxy)sulfonic acid details
1,3-diphenylpropan-2-ol → [(1,3-diphenylpropan-2-yl)oxy]sulfonic acid details
1,3-diphenylbut-3-en-2-ol → [(1,3-diphenylbut-3-en-2-yl)oxy]sulfonic acid details
1,3-diphenylbut-3-en-1-ol → [(1,3-diphenylbut-3-en-1-yl)oxy]sulfonic acid details
(2E)-1-(4-methoxyphenyl)-3-phenylprop-2-en-1-ol → {[(2E)-1-(4-methoxyphenyl)-3-phenylprop-2-en-1-yl]oxy}sulfonic acid details
3-hydroxy-1-(4-methoxyphenyl)-3-phenylpropan-1-one → [3-(4-methoxyphenyl)-3-oxo-1-phenylpropoxy]sulfonic acid details
1-(4-methoxyphenyl)-3-phenylpropan-1-ol → [1-(4-methoxyphenyl)-3-phenylpropoxy]sulfonic acid details
3-(4-methoxyphenyl)prop-2-en-1-ol → {[3-(4-methoxyphenyl)prop-2-en-1-yl]oxy}sulfonic acid details
4-(3-hydroxyprop-1-en-1-yl)phenol → {[3-(4-hydroxyphenyl)prop-2-en-1-yl]oxy}sulfonic acid details
2-(3-hydroxyprop-1-en-1-yl)-5-methoxyphenol → {[3-(2-hydroxy-4-methoxyphenyl)prop-2-en-1-yl]oxy}sulfonic acid details
[3-(4-methoxyphenyl)oxiran-2-yl]methanol → {[3-(4-methoxyphenyl)oxiran-2-yl]methoxy}sulfonic acid details
1-hydroxy-4-(4-hydroxy-3-methoxyphenyl)but-3-en-2-one → {[4-(4-hydroxy-3-methoxyphenyl)-2-oxobut-3-en-1-yl]oxy}sulfonic acid details
4-(3-hydroxybut-1-en-1-yl)-2-methoxyphenol → {[4-(4-hydroxy-3-methoxyphenyl)but-3-en-2-yl]oxy}sulfonic acid details
4-hydroxy-4-(4-hydroxy-3-methoxyphenyl)butan-2-one → [1-(4-hydroxy-3-methoxyphenyl)-3-oxobutoxy]sulfonic acid details
1-hydroxy-4-(4-hydroxy-3-methoxyphenyl)butan-2-one → [4-(4-hydroxy-3-methoxyphenyl)-2-oxobutoxy]sulfonic acid details
3-hydroxy-4-(4-hydroxy-3-methoxyphenyl)butan-2-one → {[1-(4-hydroxy-3-methoxyphenyl)-3-oxobutan-2-yl]oxy}sulfonic acid details
4-(3-hydroxybutyl)-2-methoxyphenol → {[4-(4-hydroxy-3-methoxyphenyl)butan-2-yl]oxy}sulfonic acid details
3-(2-hydroxy-4-methoxyphenyl)-8-(hydroxymethyl)-8-methyl-2H,8H-pyrano[2,3-f]chromen-2-one → {[3-(2-hydroxy-4-methoxyphenyl)-8-methyl-2-oxo-2H,8H-pyrano[2,3-f]chromen-8-yl]methoxy}sulfonic acid details
2-hydroxy-3-(4-methoxyphenyl)propanal → {[1-(4-methoxyphenyl)-3-oxopropan-2-yl]oxy}sulfonic acid details
3-hydroxy-3-(4-methoxyphenyl)propanal → [1-(4-methoxyphenyl)-3-oxopropoxy]sulfonic acid details
3-(4-methoxyphenyl)propan-1-ol → [3-(4-methoxyphenyl)propoxy]sulfonic acid details
3-[1-hydroxy-2-(2-hydroxyphenyl)ethyl]-5-methoxyphenol → [1-(3-hydroxy-5-methoxyphenyl)-2-(2-hydroxyphenyl)ethoxy]sulfonic acid details
3-[2-hydroxy-2-(2-hydroxyphenyl)ethyl]-5-methoxyphenol → [2-(3-hydroxy-5-methoxyphenyl)-1-(2-hydroxyphenyl)ethoxy]sulfonic acid details
7-(hydroxymethyl)-6-[(E)-2-methoxyethenyl]-2H-chromen-2-one → ({6-[(E)-2-methoxyethenyl]-2-oxo-2H-chromen-7-yl}methoxy)sulfonic acid details
6-(4-hydroxy-3-methylbut-2-en-1-yl)-14-methoxy-8,17-dioxatetracyclo[8.7.0.0²,⁷.0¹¹,¹⁶]heptadeca-2(7),3,5,11(16),12,14-hexaen-5-ol → [(4-{5-hydroxy-14-methoxy-8,17-dioxatetracyclo[8.7.0.0²,⁷.0¹¹,¹⁶]heptadeca-2(7),3,5,11(16),12,14-hexaen-6-yl}-2-methylbut-2-en-1-yl)oxy]sulfonic acid details
3-(2,4-dihydroxyphenyl)-5-methoxy-3,4-dihydro-2H-1-benzopyran-4,7-diol → [3-(2,4-dihydroxyphenyl)-7-hydroxy-5-methoxy-3,4-dihydro-2H-1-benzopyran-4-yl]oxidanesulfonic acid details
3-(2,4-dihydroxyphenyl)-5-methoxy-3,4-dihydro-2H-1-benzopyran-4,6,7-triol → [3-(2,4-dihydroxyphenyl)-6,7-dihydroxy-5-methoxy-3,4-dihydro-2H-1-benzopyran-4-yl]oxidanesulfonic acid details
5-(4,7-dihydroxy-5-methoxy-3,4-dihydro-2H-1-benzopyran-3-yl)benzene-1,2,4-triol → [7-hydroxy-5-methoxy-3-(2,4,5-trihydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-yl]oxidanesulfonic acid details
4-(4,7-dihydroxy-5-methoxy-3,4-dihydro-2H-1-benzopyran-3-yl)benzene-1,2,3-triol → [7-hydroxy-5-methoxy-3-(2,3,4-trihydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-yl]oxidanesulfonic acid details
Zeranol → (14,16-dihydroxy-3-methyl-1-oxo-3,4,5,6,7,8,9,10,11,12-decahydro-1H-2-benzoxacyclotetradecin-7-yl)oxidanesulfonic acid details
7,14,16-trihydroxy-3-(hydroxymethyl)-3,4,5,6,7,8,9,10,11,12-decahydro-1H-2-benzoxacyclotetradecin-1-one → [(7,14,16-trihydroxy-1-oxo-3,4,5,6,7,8,9,10,11,12-decahydro-1H-2-benzoxacyclotetradecin-3-yl)methoxy]sulfonic acid details
7,14,16-trihydroxy-3-(hydroxymethyl)-3,4,5,6,7,8,9,10,11,12-decahydro-1H-2-benzoxacyclotetradecin-1-one → [14,16-dihydroxy-3-(hydroxymethyl)-1-oxo-3,4,5,6,7,8,9,10,11,12-decahydro-1H-2-benzoxacyclotetradecin-7-yl]oxidanesulfonic acid details
7,14,15,16-tetrahydroxy-3-methyl-3,4,5,6,7,8,9,10,11,12-decahydro-1H-2-benzoxacyclotetradecin-1-one → (14,15,16-trihydroxy-3-methyl-1-oxo-3,4,5,6,7,8,9,10,11,12-decahydro-1H-2-benzoxacyclotetradecin-7-yl)oxidanesulfonic acid details
7,12,14,16-tetrahydroxy-3-methyl-3,4,5,6,7,8,9,10,11,12-decahydro-1H-2-benzoxacyclotetradecin-1-one → (7,14,16-trihydroxy-3-methyl-1-oxo-3,4,5,6,7,8,9,10,11,12-decahydro-1H-2-benzoxacyclotetradecin-12-yl)oxidanesulfonic acid details
7,12,14,16-tetrahydroxy-3-methyl-3,4,5,6,7,8,9,10,11,12-decahydro-1H-2-benzoxacyclotetradecin-1-one → (12,14,16-trihydroxy-3-methyl-1-oxo-3,4,5,6,7,8,9,10,11,12-decahydro-1H-2-benzoxacyclotetradecin-7-yl)oxidanesulfonic acid details
4-{[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxy}-2-(3,4,5-trihydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-3,5,7-triol → (5,7-dihydroxy-4-{[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxy}-2-(3,4,5-trihydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-3-yl)oxidanesulfonic acid details
2-(3,4,5-trihydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-3,4,5,7-tetrol → [4,5,7-trihydroxy-2-(3,4,5-trihydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-3-yl]oxidanesulfonic acid details
2-(3,4,5-trihydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-3,4,5,7-tetrol → [3,5,7-trihydroxy-2-(3,4,5-trihydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-yl]oxidanesulfonic acid details
2-(3,5-dihydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-3,4,5,7-tetrol → [2-(3,5-dihydroxyphenyl)-4,5,7-trihydroxy-3,4-dihydro-2H-1-benzopyran-3-yl]oxidanesulfonic acid details
2-(3,5-dihydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-3,4,5,7-tetrol → [2-(3,5-dihydroxyphenyl)-3,5,7-trihydroxy-3,4-dihydro-2H-1-benzopyran-4-yl]oxidanesulfonic acid details
2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-3,4,5,7-tetrol → [4,5,7-trihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-3-yl]oxidanesulfonic acid details
2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-3,4,5,7-tetrol → [3,5,7-trihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-yl]oxidanesulfonic acid details
ent-Epiafzelechin(2a->7,4a->8)epiafzelechin 3-(4-hydroxybenzoic acid) → [9,17,19-trihydroxy-21-(4-hydroxybenzoyloxy)-5,13-bis(4-hydroxyphenyl)-4,12,14-trioxapentacyclo[11.7.1.0²,¹¹.0³,⁸.0¹⁵,²⁰]henicosa-2(11),3(8),9,15,17,19-hexaen-6-yl]oxidanesulfonic acid details
(2S,2''S,3S,3''R,4S)-3,4',5,7-Tetrahydroxyflavan(2->7,4->8)-3,4',5,7-tetrahydroxyflavan → [6,9,17,19-tetrahydroxy-5,13-bis(4-hydroxyphenyl)-4,12,14-trioxapentacyclo[11.7.1.0²,¹¹.0³,⁸.0¹⁵,²⁰]henicosa-2(11),3(8),9,15,17,19-hexaen-21-yl]oxidanesulfonic acid details
(2S,2''S,3S,3''R,4S)-3,4',5,7-Tetrahydroxyflavan(2->7,4->8)-3,4',5,7-tetrahydroxyflavan → [9,17,19,21-tetrahydroxy-5,13-bis(4-hydroxyphenyl)-4,12,14-trioxapentacyclo[11.7.1.0²,¹¹.0³,⁸.0¹⁵,²⁰]henicosa-2(11),3(8),9,15,17,19-hexaen-6-yl]oxidanesulfonic acid details
5,13-bis(4-hydroxyphenyl)-4,12,14-trioxapentacyclo[11.7.1.0²,¹¹.0³,⁸.0¹⁵,²⁰]henicosa-2(11),3(8),9,15(20),16,18-hexaene-6,9,17,18,19,21-hexol → [6,9,17,18,19-pentahydroxy-5,13-bis(4-hydroxyphenyl)-4,12,14-trioxapentacyclo[11.7.1.0²,¹¹.0³,⁸.0¹⁵,²⁰]henicosa-2(11),3(8),9,15(20),16,18-hexaen-21-yl]oxidanesulfonic acid details
5,13-bis(4-hydroxyphenyl)-4,12,14-trioxapentacyclo[11.7.1.0²,¹¹.0³,⁸.0¹⁵,²⁰]henicosa-2(11),3(8),9,15(20),16,18-hexaene-6,9,17,18,19,21-hexol → [9,17,18,19,21-pentahydroxy-5,13-bis(4-hydroxyphenyl)-4,12,14-trioxapentacyclo[11.7.1.0²,¹¹.0³,⁸.0¹⁵,²⁰]henicosa-2(11),3(8),9,15(20),16,18-hexaen-6-yl]oxidanesulfonic acid details
13-(3,4-dihydroxyphenyl)-5-(4-hydroxyphenyl)-4,12,14-trioxapentacyclo[11.7.1.0²,¹¹.0³,⁸.0¹⁵,²⁰]henicosa-2(11),3(8),9,15,17,19-hexaene-6,9,17,19,21-pentol → [13-(3,4-dihydroxyphenyl)-6,9,17,19-tetrahydroxy-5-(4-hydroxyphenyl)-4,12,14-trioxapentacyclo[11.7.1.0²,¹¹.0³,⁸.0¹⁵,²⁰]henicosa-2(11),3(8),9,15,17,19-hexaen-21-yl]oxidanesulfonic acid details
13-(3,4-dihydroxyphenyl)-5-(4-hydroxyphenyl)-4,12,14-trioxapentacyclo[11.7.1.0²,¹¹.0³,⁸.0¹⁵,²⁰]henicosa-2(11),3(8),9,15,17,19-hexaene-6,9,17,19,21-pentol → [13-(3,4-dihydroxyphenyl)-9,17,19,21-tetrahydroxy-5-(4-hydroxyphenyl)-4,12,14-trioxapentacyclo[11.7.1.0²,¹¹.0³,⁸.0¹⁵,²⁰]henicosa-2(11),3(8),9,15,17,19-hexaen-6-yl]oxidanesulfonic acid details
Prunus inhibitor b → [5-(3,4-dihydroxyphenyl)-6,9,17,19-tetrahydroxy-13-(4-hydroxyphenyl)-4,12,14-trioxapentacyclo[11.7.1.0²,¹¹.0³,⁸.0¹⁵,²⁰]henicosa-2(11),3(8),9,15,17,19-hexaen-21-yl]oxidanesulfonic acid details
Prunus inhibitor b → [5-(3,4-dihydroxyphenyl)-9,17,19,21-tetrahydroxy-13-(4-hydroxyphenyl)-4,12,14-trioxapentacyclo[11.7.1.0²,¹¹.0³,⁸.0¹⁵,²⁰]henicosa-2(11),3(8),9,15,17,19-hexaen-6-yl]oxidanesulfonic acid details
5-(4-hydroxyphenyl)-13-phenyl-4,12,14-trioxapentacyclo[11.7.1.0²,¹¹.0³,⁸.0¹⁵,²⁰]henicosa-2(11),3(8),9,15,17,19-hexaene-6,9,17,19,21-pentol → [6,9,17,19-tetrahydroxy-5-(4-hydroxyphenyl)-13-phenyl-4,12,14-trioxapentacyclo[11.7.1.0²,¹¹.0³,⁸.0¹⁵,²⁰]henicosa-2(11),3(8),9,15,17,19-hexaen-21-yl]oxidanesulfonic acid details
5-(4-hydroxyphenyl)-13-phenyl-4,12,14-trioxapentacyclo[11.7.1.0²,¹¹.0³,⁸.0¹⁵,²⁰]henicosa-2(11),3(8),9,15,17,19-hexaene-6,9,17,19,21-pentol → [9,17,19,21-tetrahydroxy-5-(4-hydroxyphenyl)-13-phenyl-4,12,14-trioxapentacyclo[11.7.1.0²,¹¹.0³,⁸.0¹⁵,²⁰]henicosa-2(11),3(8),9,15,17,19-hexaen-6-yl]oxidanesulfonic acid details
13-(4-hydroxyphenyl)-5-phenyl-4,12,14-trioxapentacyclo[11.7.1.0²,¹¹.0³,⁸.0¹⁵,²⁰]henicosa-2(11),3(8),9,15,17,19-hexaene-6,9,17,19,21-pentol → [6,9,17,19-tetrahydroxy-13-(4-hydroxyphenyl)-5-phenyl-4,12,14-trioxapentacyclo[11.7.1.0²,¹¹.0³,⁸.0¹⁵,²⁰]henicosa-2(11),3(8),9,15,17,19-hexaen-21-yl]oxidanesulfonic acid details
13-(4-hydroxyphenyl)-5-phenyl-4,12,14-trioxapentacyclo[11.7.1.0²,¹¹.0³,⁸.0¹⁵,²⁰]henicosa-2(11),3(8),9,15,17,19-hexaene-6,9,17,19,21-pentol → [9,17,19,21-tetrahydroxy-13-(4-hydroxyphenyl)-5-phenyl-4,12,14-trioxapentacyclo[11.7.1.0²,¹¹.0³,⁸.0¹⁵,²⁰]henicosa-2(11),3(8),9,15,17,19-hexaen-6-yl]oxidanesulfonic acid details
5,13-diphenyl-4,12,14-trioxapentacyclo[11.7.1.0²,¹¹.0³,⁸.0¹⁵,²⁰]henicosa-2(11),3(8),9,15,17,19-hexaene-6,9,17,19,21-pentol → {6,9,17,19-tetrahydroxy-5,13-diphenyl-4,12,14-trioxapentacyclo[11.7.1.0²,¹¹.0³,⁸.0¹⁵,²⁰]henicosa-2(11),3(8),9,15,17,19-hexaen-21-yl}oxidanesulfonic acid details
5,13-diphenyl-4,12,14-trioxapentacyclo[11.7.1.0²,¹¹.0³,⁸.0¹⁵,²⁰]henicosa-2(11),3(8),9,15,17,19-hexaene-6,9,17,19,21-pentol → {9,17,19,21-tetrahydroxy-5,13-diphenyl-4,12,14-trioxapentacyclo[11.7.1.0²,¹¹.0³,⁸.0¹⁵,²⁰]henicosa-2(11),3(8),9,15,17,19-hexaen-6-yl}oxidanesulfonic acid details
5-(4-hydroxyphenyl)-13-phenyl-4,12,14-trioxapentacyclo[11.7.1.0²,¹¹.0³,⁸.0¹⁵,²⁰]henicosa-2(11),3(8),9,15(20),16,18-hexaene-6,9,17,18,19,21-hexol → [6,9,17,18,19-pentahydroxy-5-(4-hydroxyphenyl)-13-phenyl-4,12,14-trioxapentacyclo[11.7.1.0²,¹¹.0³,⁸.0¹⁵,²⁰]henicosa-2(11),3(8),9,15(20),16,18-hexaen-21-yl]oxidanesulfonic acid details
5-(4-hydroxyphenyl)-13-phenyl-4,12,14-trioxapentacyclo[11.7.1.0²,¹¹.0³,⁸.0¹⁵,²⁰]henicosa-2(11),3(8),9,15(20),16,18-hexaene-6,9,17,18,19,21-hexol → [9,17,18,19,21-pentahydroxy-5-(4-hydroxyphenyl)-13-phenyl-4,12,14-trioxapentacyclo[11.7.1.0²,¹¹.0³,⁸.0¹⁵,²⁰]henicosa-2(11),3(8),9,15(20),16,18-hexaen-6-yl]oxidanesulfonic acid details
13-(4-hydroxyphenyl)-5-phenyl-4,12,14-trioxapentacyclo[11.7.1.0²,¹¹.0³,⁸.0¹⁵,²⁰]henicosa-2(11),3(8),9,15(20),16,18-hexaene-6,9,17,18,19,21-hexol → [6,9,17,18,19-pentahydroxy-13-(4-hydroxyphenyl)-5-phenyl-4,12,14-trioxapentacyclo[11.7.1.0²,¹¹.0³,⁸.0¹⁵,²⁰]henicosa-2(11),3(8),9,15(20),16,18-hexaen-21-yl]oxidanesulfonic acid details
13-(4-hydroxyphenyl)-5-phenyl-4,12,14-trioxapentacyclo[11.7.1.0²,¹¹.0³,⁸.0¹⁵,²⁰]henicosa-2(11),3(8),9,15(20),16,18-hexaene-6,9,17,18,19,21-hexol → [9,17,18,19,21-pentahydroxy-13-(4-hydroxyphenyl)-5-phenyl-4,12,14-trioxapentacyclo[11.7.1.0²,¹¹.0³,⁸.0¹⁵,²⁰]henicosa-2(11),3(8),9,15(20),16,18-hexaen-6-yl]oxidanesulfonic acid details
5,13-diphenyl-4,12,14-trioxapentacyclo[11.7.1.0²,¹¹.0³,⁸.0¹⁵,²⁰]henicosa-2(11),3(8),9,15(20),16,18-hexaene-6,9,17,18,19,21-hexol → {6,9,17,18,19-pentahydroxy-5,13-diphenyl-4,12,14-trioxapentacyclo[11.7.1.0²,¹¹.0³,⁸.0¹⁵,²⁰]henicosa-2(11),3(8),9,15(20),16,18-hexaen-21-yl}oxidanesulfonic acid details
5,13-diphenyl-4,12,14-trioxapentacyclo[11.7.1.0²,¹¹.0³,⁸.0¹⁵,²⁰]henicosa-2(11),3(8),9,15(20),16,18-hexaene-6,9,17,18,19,21-hexol → {9,17,18,19,21-pentahydroxy-5,13-diphenyl-4,12,14-trioxapentacyclo[11.7.1.0²,¹¹.0³,⁸.0¹⁵,²⁰]henicosa-2(11),3(8),9,15(20),16,18-hexaen-6-yl}oxidanesulfonic acid details
13-(3-hydroxyphenyl)-5-(4-hydroxyphenyl)-4,12,14-trioxapentacyclo[11.7.1.0²,¹¹.0³,⁸.0¹⁵,²⁰]henicosa-2(11),3(8),9,15,17,19-hexaene-6,9,17,19,21-pentol → [6,9,17,19-tetrahydroxy-13-(3-hydroxyphenyl)-5-(4-hydroxyphenyl)-4,12,14-trioxapentacyclo[11.7.1.0²,¹¹.0³,⁸.0¹⁵,²⁰]henicosa-2(11),3(8),9,15,17,19-hexaen-21-yl]oxidanesulfonic acid details
13-(3-hydroxyphenyl)-5-(4-hydroxyphenyl)-4,12,14-trioxapentacyclo[11.7.1.0²,¹¹.0³,⁸.0¹⁵,²⁰]henicosa-2(11),3(8),9,15,17,19-hexaene-6,9,17,19,21-pentol → [9,17,19,21-tetrahydroxy-13-(3-hydroxyphenyl)-5-(4-hydroxyphenyl)-4,12,14-trioxapentacyclo[11.7.1.0²,¹¹.0³,⁸.0¹⁵,²⁰]henicosa-2(11),3(8),9,15,17,19-hexaen-6-yl]oxidanesulfonic acid details
13-(3,4-dihydroxyphenyl)-5-phenyl-4,12,14-trioxapentacyclo[11.7.1.0²,¹¹.0³,⁸.0¹⁵,²⁰]henicosa-2(11),3(8),9,15,17,19-hexaene-6,9,17,19,21-pentol → [13-(3,4-dihydroxyphenyl)-6,9,17,19-tetrahydroxy-5-phenyl-4,12,14-trioxapentacyclo[11.7.1.0²,¹¹.0³,⁸.0¹⁵,²⁰]henicosa-2(11),3(8),9,15,17,19-hexaen-21-yl]oxidanesulfonic acid details
13-(3,4-dihydroxyphenyl)-5-phenyl-4,12,14-trioxapentacyclo[11.7.1.0²,¹¹.0³,⁸.0¹⁵,²⁰]henicosa-2(11),3(8),9,15,17,19-hexaene-6,9,17,19,21-pentol → [13-(3,4-dihydroxyphenyl)-9,17,19,21-tetrahydroxy-5-phenyl-4,12,14-trioxapentacyclo[11.7.1.0²,¹¹.0³,⁸.0¹⁵,²⁰]henicosa-2(11),3(8),9,15,17,19-hexaen-6-yl]oxidanesulfonic acid details
13-(3-hydroxyphenyl)-5-phenyl-4,12,14-trioxapentacyclo[11.7.1.0²,¹¹.0³,⁸.0¹⁵,²⁰]henicosa-2(11),3(8),9,15,17,19-hexaene-6,9,17,19,21-pentol → [6,9,17,19-tetrahydroxy-13-(3-hydroxyphenyl)-5-phenyl-4,12,14-trioxapentacyclo[11.7.1.0²,¹¹.0³,⁸.0¹⁵,²⁰]henicosa-2(11),3(8),9,15,17,19-hexaen-21-yl]oxidanesulfonic acid details
13-(3-hydroxyphenyl)-5-phenyl-4,12,14-trioxapentacyclo[11.7.1.0²,¹¹.0³,⁸.0¹⁵,²⁰]henicosa-2(11),3(8),9,15,17,19-hexaene-6,9,17,19,21-pentol → [9,17,19,21-tetrahydroxy-13-(3-hydroxyphenyl)-5-phenyl-4,12,14-trioxapentacyclo[11.7.1.0²,¹¹.0³,⁸.0¹⁵,²⁰]henicosa-2(11),3(8),9,15,17,19-hexaen-6-yl]oxidanesulfonic acid details
5-(3,4-dihydroxyphenyl)-13-phenyl-4,12,14-trioxapentacyclo[11.7.1.0²,¹¹.0³,⁸.0¹⁵,²⁰]henicosa-2(11),3(8),9,15,17,19-hexaene-6,9,17,19,21-pentol → [5-(3,4-dihydroxyphenyl)-6,9,17,19-tetrahydroxy-13-phenyl-4,12,14-trioxapentacyclo[11.7.1.0²,¹¹.0³,⁸.0¹⁵,²⁰]henicosa-2(11),3(8),9,15,17,19-hexaen-21-yl]oxidanesulfonic acid details
5-(3,4-dihydroxyphenyl)-13-phenyl-4,12,14-trioxapentacyclo[11.7.1.0²,¹¹.0³,⁸.0¹⁵,²⁰]henicosa-2(11),3(8),9,15,17,19-hexaene-6,9,17,19,21-pentol → [5-(3,4-dihydroxyphenyl)-9,17,19,21-tetrahydroxy-13-phenyl-4,12,14-trioxapentacyclo[11.7.1.0²,¹¹.0³,⁸.0¹⁵,²⁰]henicosa-2(11),3(8),9,15,17,19-hexaen-6-yl]oxidanesulfonic acid details
5-(3-hydroxyphenyl)-13-(4-hydroxyphenyl)-4,12,14-trioxapentacyclo[11.7.1.0²,¹¹.0³,⁸.0¹⁵,²⁰]henicosa-2(11),3(8),9,15,17,19-hexaene-6,9,17,19,21-pentol → [6,9,17,19-tetrahydroxy-5-(3-hydroxyphenyl)-13-(4-hydroxyphenyl)-4,12,14-trioxapentacyclo[11.7.1.0²,¹¹.0³,⁸.0¹⁵,²⁰]henicosa-2(11),3(8),9,15,17,19-hexaen-21-yl]oxidanesulfonic acid details
5-(3-hydroxyphenyl)-13-(4-hydroxyphenyl)-4,12,14-trioxapentacyclo[11.7.1.0²,¹¹.0³,⁸.0¹⁵,²⁰]henicosa-2(11),3(8),9,15,17,19-hexaene-6,9,17,19,21-pentol → [9,17,19,21-tetrahydroxy-5-(3-hydroxyphenyl)-13-(4-hydroxyphenyl)-4,12,14-trioxapentacyclo[11.7.1.0²,¹¹.0³,⁸.0¹⁵,²⁰]henicosa-2(11),3(8),9,15,17,19-hexaen-6-yl]oxidanesulfonic acid details
5-(3-hydroxyphenyl)-13-phenyl-4,12,14-trioxapentacyclo[11.7.1.0²,¹¹.0³,⁸.0¹⁵,²⁰]henicosa-2(11),3(8),9,15,17,19-hexaene-6,9,17,19,21-pentol → [6,9,17,19-tetrahydroxy-5-(3-hydroxyphenyl)-13-phenyl-4,12,14-trioxapentacyclo[11.7.1.0²,¹¹.0³,⁸.0¹⁵,²⁰]henicosa-2(11),3(8),9,15,17,19-hexaen-21-yl]oxidanesulfonic acid details
5-(3-hydroxyphenyl)-13-phenyl-4,12,14-trioxapentacyclo[11.7.1.0²,¹¹.0³,⁸.0¹⁵,²⁰]henicosa-2(11),3(8),9,15,17,19-hexaene-6,9,17,19,21-pentol → [9,17,19,21-tetrahydroxy-5-(3-hydroxyphenyl)-13-phenyl-4,12,14-trioxapentacyclo[11.7.1.0²,¹¹.0³,⁸.0¹⁵,²⁰]henicosa-2(11),3(8),9,15,17,19-hexaen-6-yl]oxidanesulfonic acid details
N-[2-hydroxy-2-(4-hydroxyphenyl)ethyl]-3-(4-hydroxyphenyl)propanimidic acid → 3-(4-hydroxyphenyl)-N-[2-(4-hydroxyphenyl)-2-(sulfooxy)ethyl]propanimidic acid details
(2E)-N-[2-(3,4-dihydroxyphenyl)-2-hydroxyethyl]-3-(4-hydroxyphenyl)prop-2-enimidic acid → (2E)-N-[2-(3,4-dihydroxyphenyl)-2-(sulfooxy)ethyl]-3-(4-hydroxyphenyl)prop-2-enimidic acid details
(2E)-3-(2,4-dihydroxyphenyl)-N-[2-hydroxy-2-(4-hydroxyphenyl)ethyl]prop-2-enimidic acid → (2E)-3-(2,4-dihydroxyphenyl)-N-[2-(4-hydroxyphenyl)-2-(sulfooxy)ethyl]prop-2-enimidic acid details
(2E)-3-(3,4-dihydroxyphenyl)-N-[2-hydroxy-2-(4-hydroxyphenyl)ethyl]prop-2-enimidic acid → (2E)-3-(3,4-dihydroxyphenyl)-N-[2-(4-hydroxyphenyl)-2-(sulfooxy)ethyl]prop-2-enimidic acid details
N-[2-hydroxy-2-(4-hydroxyphenyl)ethyl]-3-(4-hydroxyphenyl)oxirane-2-carboximidic acid → 3-(4-hydroxyphenyl)-N-[2-(4-hydroxyphenyl)-2-(sulfooxy)ethyl]oxirane-2-carboximidic acid details
(2E)-N-[2-hydroxy-2-(1-hydroxy-4-oxocyclohexa-2,5-dien-1-yl)ethyl]-3-(4-hydroxyphenyl)prop-2-enimidic acid → (2E)-N-[2-(1-hydroxy-4-oxocyclohexa-2,5-dien-1-yl)-2-(sulfooxy)ethyl]-3-(4-hydroxyphenyl)prop-2-enimidic acid details
(2E)-N-[2-hydroxy-2-(4-hydroxyphenyl)ethyl]-3-(1-hydroxy-4-oxocyclohexa-2,5-dien-1-yl)prop-2-enimidic acid → (2E)-3-(1-hydroxy-4-oxocyclohexa-2,5-dien-1-yl)-N-[2-(4-hydroxyphenyl)-2-(sulfooxy)ethyl]prop-2-enimidic acid details
(2Z)-2-hydroxy-N-[2-hydroxy-2-(4-hydroxyphenyl)ethyl]-3-(4-hydroxyphenyl)prop-2-enimidic acid → (2Z)-2-hydroxy-3-(4-hydroxyphenyl)-N-[2-(4-hydroxyphenyl)-2-(sulfooxy)ethyl]prop-2-enimidic acid details
3-hydroxy-N-[2-hydroxy-2-(4-hydroxyphenyl)ethyl]-3-(4-hydroxyphenyl)propanimidic acid → N-[2-hydroxy-2-(4-hydroxyphenyl)ethyl]-3-(4-hydroxyphenyl)-3-(sulfooxy)propanimidic acid details
3-hydroxy-N-[2-hydroxy-2-(4-hydroxyphenyl)ethyl]-3-(4-hydroxyphenyl)propanimidic acid → 3-hydroxy-3-(4-hydroxyphenyl)-N-[2-(4-hydroxyphenyl)-2-(sulfooxy)ethyl]propanimidic acid details
N-[2-(3,4-dihydroxyphenyl)-2-hydroxyethyl]-3-(4-hydroxyphenyl)propanimidic acid → N-[2-(3,4-dihydroxyphenyl)-2-(sulfooxy)ethyl]-3-(4-hydroxyphenyl)propanimidic acid details
3-(3,4-dihydroxyphenyl)-N-[2-hydroxy-2-(4-hydroxyphenyl)ethyl]propanimidic acid → 3-(3,4-dihydroxyphenyl)-N-[2-(4-hydroxyphenyl)-2-(sulfooxy)ethyl]propanimidic acid details
2-hydroxy-N-[2-hydroxy-2-(4-hydroxyphenyl)ethyl]-3-(4-hydroxyphenyl)propanimidic acid → N-[2-hydroxy-2-(4-hydroxyphenyl)ethyl]-3-(4-hydroxyphenyl)-2-(sulfooxy)propanimidic acid details
2-hydroxy-N-[2-hydroxy-2-(4-hydroxyphenyl)ethyl]-3-(4-hydroxyphenyl)propanimidic acid → 2-hydroxy-3-(4-hydroxyphenyl)-N-[2-(4-hydroxyphenyl)-2-(sulfooxy)ethyl]propanimidic acid details
N-[2-hydroxy-2-(1-hydroxy-4-oxocyclohexa-2,5-dien-1-yl)ethyl]-3-(4-hydroxyphenyl)propanimidic acid → N-[2-(1-hydroxy-4-oxocyclohexa-2,5-dien-1-yl)-2-(sulfooxy)ethyl]-3-(4-hydroxyphenyl)propanimidic acid details
N-[2-hydroxy-2-(4-hydroxyphenyl)ethyl]-3-(1-hydroxy-4-oxocyclohexa-2,5-dien-1-yl)propanimidic acid → 3-(1-hydroxy-4-oxocyclohexa-2,5-dien-1-yl)-N-[2-(4-hydroxyphenyl)-2-(sulfooxy)ethyl]propanimidic acid details
N-[2-hydroxy-2-(4-hydroxyphenyl)ethyl]-3-(4-hydroxy-3-methoxyphenyl)prop-2-enimidic acid → 3-(4-hydroxy-3-methoxyphenyl)-N-[2-(4-hydroxyphenyl)-2-(sulfooxy)ethyl]prop-2-enimidic acid details
N-[2-hydroxy-2-(4-hydroxyphenyl)ethyl]-3-(4-hydroxy-3-methoxyphenyl)propanimidic acid → 3-(4-hydroxy-3-methoxyphenyl)-N-[2-(4-hydroxyphenyl)-2-(sulfooxy)ethyl]propanimidic acid details
3-(3,4-dihydroxyphenyl)-N-[2-hydroxy-2-(4-hydroxyphenyl)ethyl]prop-2-enimidic acid → 3-(3,4-dihydroxyphenyl)-N-[2-(4-hydroxyphenyl)-2-(sulfooxy)ethyl]prop-2-enimidic acid details
3-(3,4-dihydroxy-5-methoxyphenyl)-N-[2-hydroxy-2-(4-hydroxyphenyl)ethyl]prop-2-enimidic acid → 3-(3,4-dihydroxy-5-methoxyphenyl)-N-[2-(4-hydroxyphenyl)-2-(sulfooxy)ethyl]prop-2-enimidic acid details
3-(2,4-dihydroxy-5-methoxyphenyl)-N-[2-hydroxy-2-(4-hydroxyphenyl)ethyl]prop-2-enimidic acid → 3-(2,4-dihydroxy-5-methoxyphenyl)-N-[2-(4-hydroxyphenyl)-2-(sulfooxy)ethyl]prop-2-enimidic acid details
N-[2-(3,4-dihydroxyphenyl)-2-hydroxyethyl]-3-(4-hydroxy-3-methoxyphenyl)prop-2-enimidic acid → N-[2-(3,4-dihydroxyphenyl)-2-(sulfooxy)ethyl]-3-(4-hydroxy-3-methoxyphenyl)prop-2-enimidic acid details
3-(2,4-dihydroxy-3-methoxyphenyl)-N-[2-hydroxy-2-(4-hydroxyphenyl)ethyl]prop-2-enimidic acid → 3-(2,4-dihydroxy-3-methoxyphenyl)-N-[2-(4-hydroxyphenyl)-2-(sulfooxy)ethyl]prop-2-enimidic acid details
N-[2-hydroxy-2-(4-hydroxyphenyl)ethyl]-3-(4-hydroxy-3-methoxyphenyl)oxirane-2-carboximidic acid → 3-(4-hydroxy-3-methoxyphenyl)-N-[2-(4-hydroxyphenyl)-2-(sulfooxy)ethyl]oxirane-2-carboximidic acid details
N-[2-hydroxy-2-(4-hydroxyphenyl)ethyl]-3-(1-hydroxy-3-methoxy-4-oxocyclohexa-2,5-dien-1-yl)prop-2-enimidic acid → 3-(1-hydroxy-3-methoxy-4-oxocyclohexa-2,5-dien-1-yl)-N-[2-(4-hydroxyphenyl)-2-(sulfooxy)ethyl]prop-2-enimidic acid details
N-[2-hydroxy-2-(1-hydroxy-4-oxocyclohexa-2,5-dien-1-yl)ethyl]-3-(4-hydroxy-3-methoxyphenyl)prop-2-enimidic acid → 3-(4-hydroxy-3-methoxyphenyl)-N-[2-(1-hydroxy-4-oxocyclohexa-2,5-dien-1-yl)-2-(sulfooxy)ethyl]prop-2-enimidic acid details
(2Z)-2-hydroxy-N-[2-hydroxy-2-(4-hydroxyphenyl)ethyl]-3-(4-hydroxy-3-methoxyphenyl)prop-2-enimidic acid → (2Z)-2-hydroxy-3-(4-hydroxy-3-methoxyphenyl)-N-[2-(4-hydroxyphenyl)-2-(sulfooxy)ethyl]prop-2-enimidic acid details
3-(3,4-dihydroxy-5-methoxyphenyl)-N-[2-hydroxy-2-(4-hydroxyphenyl)ethyl]propanimidic acid → 3-(3,4-dihydroxy-5-methoxyphenyl)-N-[2-(4-hydroxyphenyl)-2-(sulfooxy)ethyl]propanimidic acid details
N-[2-(3,4-dihydroxyphenyl)-2-hydroxyethyl]-3-(4-hydroxy-3-methoxyphenyl)propanimidic acid → N-[2-(3,4-dihydroxyphenyl)-2-(sulfooxy)ethyl]-3-(4-hydroxy-3-methoxyphenyl)propanimidic acid details
3-hydroxy-N-[2-hydroxy-2-(4-hydroxyphenyl)ethyl]-3-(4-hydroxy-3-methoxyphenyl)propanimidic acid → N-[2-hydroxy-2-(4-hydroxyphenyl)ethyl]-3-(4-hydroxy-3-methoxyphenyl)-3-(sulfooxy)propanimidic acid details
3-hydroxy-N-[2-hydroxy-2-(4-hydroxyphenyl)ethyl]-3-(4-hydroxy-3-methoxyphenyl)propanimidic acid → 3-hydroxy-3-(4-hydroxy-3-methoxyphenyl)-N-[2-(4-hydroxyphenyl)-2-(sulfooxy)ethyl]propanimidic acid details
2-hydroxy-N-[2-hydroxy-2-(4-hydroxyphenyl)ethyl]-3-(4-hydroxy-3-methoxyphenyl)propanimidic acid → N-[2-hydroxy-2-(4-hydroxyphenyl)ethyl]-3-(4-hydroxy-3-methoxyphenyl)-2-(sulfooxy)propanimidic acid details
2-hydroxy-N-[2-hydroxy-2-(4-hydroxyphenyl)ethyl]-3-(4-hydroxy-3-methoxyphenyl)propanimidic acid → 2-hydroxy-3-(4-hydroxy-3-methoxyphenyl)-N-[2-(4-hydroxyphenyl)-2-(sulfooxy)ethyl]propanimidic acid details
N-[2-hydroxy-2-(4-hydroxyphenyl)ethyl]-3-(1-hydroxy-3-methoxy-4-oxocyclohexa-2,5-dien-1-yl)propanimidic acid → 3-(1-hydroxy-3-methoxy-4-oxocyclohexa-2,5-dien-1-yl)-N-[2-(4-hydroxyphenyl)-2-(sulfooxy)ethyl]propanimidic acid details
N-[2-hydroxy-2-(1-hydroxy-4-oxocyclohexa-2,5-dien-1-yl)ethyl]-3-(4-hydroxy-3-methoxyphenyl)propanimidic acid → 3-(4-hydroxy-3-methoxyphenyl)-N-[2-(1-hydroxy-4-oxocyclohexa-2,5-dien-1-yl)-2-(sulfooxy)ethyl]propanimidic acid details
2-(1,2-dihydroxypropan-2-yl)-3-hydroxy-2H,3H,7H-furo[3,2-g]chromen-7-one → (2-hydroxy-2-{3-hydroxy-7-oxo-2H,3H,7H-furo[3,2-g]chromen-2-yl}propoxy)sulfonic acid details
2-(1,2-dihydroxypropan-2-yl)-3-hydroxy-2H,3H,7H-furo[3,2-g]chromen-7-one → [2-(1,2-dihydroxypropan-2-yl)-7-oxo-2H,3H,7H-furo[3,2-g]chromen-3-yl]oxidanesulfonic acid details
7-hydroxy-3-(1-hydroxy-2-methylbut-3-en-2-yl)-6-methoxy-2H-chromen-2-one → {[2-(7-hydroxy-6-methoxy-2-oxo-2H-chromen-3-yl)-2-methylbut-3-en-1-yl]oxy}sulfonic acid details
Isotheaflavin 3'-gallate → (2-{1-[5,7-dihydroxy-3-(3,4,5-trihydroxybenzoyloxy)-3,4-dihydro-2H-1-benzopyran-2-yl]-3,4,6-trihydroxy-5-oxo-5H-benzo[7]annulen-8-yl}-5,7-dihydroxy-3,4-dihydro-2H-1-benzopyran-3-yl)oxidanesulfonic acid details
Isotheaflavin → {5,7-dihydroxy-2-[3,4,6-trihydroxy-5-oxo-8-(3,5,7-trihydroxy-3,4-dihydro-2H-1-benzopyran-2-yl)-5H-benzo[7]annulen-1-yl]-3,4-dihydro-2H-1-benzopyran-3-yl}oxidanesulfonic acid details
Isotheaflavin → {5,7-dihydroxy-2-[3,4,6-trihydroxy-5-oxo-1-(3,5,7-trihydroxy-3,4-dihydro-2H-1-benzopyran-2-yl)-5H-benzo[7]annulen-8-yl]-3,4-dihydro-2H-1-benzopyran-3-yl}oxidanesulfonic acid details
Neotheaflavin 3-gallate → (2-{8-[5,7-dihydroxy-3-(3,4,5-trihydroxybenzoyloxy)-3,4-dihydro-2H-1-benzopyran-2-yl]-3,4,6-trihydroxy-5-oxo-5H-benzo[7]annulen-1-yl}-5,7-dihydroxy-3,4-dihydro-2H-1-benzopyran-3-yl)oxidanesulfonic acid details
Meloside L → ({6-[2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-4-oxo-4H-chromen-6-yl]-3,4-dihydroxy-5-{[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxy}oxan-2-yl}methoxy)sulfonic acid details
Meloside L → {6-[2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-4-oxo-4H-chromen-6-yl]-4-hydroxy-2-(hydroxymethyl)-5-{[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxy}oxan-3-yl}oxidanesulfonic acid details
Meloside L → {2-[2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-4-oxo-4H-chromen-6-yl]-5-hydroxy-6-(hydroxymethyl)-3-{[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxy}oxan-4-yl}oxidanesulfonic acid details
5-[(4-hydroxy-3-methylbut-2-en-1-yl)oxy]-7-methoxy-2H-chromen-2-one → ({4-[(7-methoxy-2-oxo-2H-chromen-5-yl)oxy]-2-methylbut-2-en-1-yl}oxy)sulfonic acid details
Prenol → [(3-methylbut-2-en-1-yl)oxy]sulfonic acid details
5-[(6-hydroxy-3,7-dimethylocta-2,7-dien-1-yl)oxy]-7-methoxy-2H-chromen-2-one → ({8-[(7-methoxy-2-oxo-2H-chromen-5-yl)oxy]-2,6-dimethylocta-1,6-dien-3-yl}oxy)sulfonic acid details
5-[(5,6-dihydroxy-3,7-dimethylocta-2,7-dien-1-yl)oxy]-7-methoxy-2H-chromen-2-one → ({3-hydroxy-8-[(7-methoxy-2-oxo-2H-chromen-5-yl)oxy]-2,6-dimethylocta-1,6-dien-4-yl}oxy)sulfonic acid details
5-[(5,6-dihydroxy-3,7-dimethylocta-2,7-dien-1-yl)oxy]-7-methoxy-2H-chromen-2-one → ({4-hydroxy-8-[(7-methoxy-2-oxo-2H-chromen-5-yl)oxy]-2,6-dimethylocta-1,6-dien-3-yl}oxy)sulfonic acid details
6-hydroxy-5-[(6-hydroxy-3,7-dimethylocta-2,7-dien-1-yl)oxy]-7-methoxy-2H-chromen-2-one → ({8-[(6-hydroxy-7-methoxy-2-oxo-2H-chromen-5-yl)oxy]-2,6-dimethylocta-1,6-dien-3-yl}oxy)sulfonic acid details
6-hydroxy-3,7-dimethylocta-2,7-dienal → [(2,6-dimethyl-8-oxoocta-1,6-dien-3-yl)oxy]sulfonic acid details
7-hydroxy-5-[(6-hydroxy-3,7-dimethylocta-2,7-dien-1-yl)oxy]-2H-chromen-2-one → ({8-[(7-hydroxy-2-oxo-2H-chromen-5-yl)oxy]-2,6-dimethylocta-1,6-dien-3-yl}oxy)sulfonic acid details
5-[(6,8-dihydroxy-3-methyl-7-methylideneoct-2-en-1-yl)oxy]-7-methoxy-2H-chromen-2-one → ({3-hydroxy-8-[(7-methoxy-2-oxo-2H-chromen-5-yl)oxy]-6-methyl-2-methylideneoct-6-en-1-yl}oxy)sulfonic acid details
5-[(6,8-dihydroxy-3-methyl-7-methylideneoct-2-en-1-yl)oxy]-7-methoxy-2H-chromen-2-one → ({1-hydroxy-8-[(7-methoxy-2-oxo-2H-chromen-5-yl)oxy]-6-methyl-2-methylideneoct-6-en-3-yl}oxy)sulfonic acid details
5-{[(2Z)-6-hydroxy-3-(hydroxymethyl)-7-methylocta-2,7-dien-1-yl]oxy}-7-methoxy-2H-chromen-2-one → {[(2Z)-5-hydroxy-2-{2-[(7-methoxy-2-oxo-2H-chromen-5-yl)oxy]ethylidene}-6-methylhept-6-en-1-yl]oxy}sulfonic acid details
5-{[(2Z)-6-hydroxy-3-(hydroxymethyl)-7-methylocta-2,7-dien-1-yl]oxy}-7-methoxy-2H-chromen-2-one → {[(6Z)-7-hydroxy-6-{2-[(7-methoxy-2-oxo-2H-chromen-5-yl)oxy]ethylidene}-2-methylhept-1-en-3-yl]oxy}sulfonic acid details
5-[(4,6-dihydroxy-3,7-dimethylocta-2,7-dien-1-yl)oxy]-7-methoxy-2H-chromen-2-one → ({6-hydroxy-1-[(7-methoxy-2-oxo-2H-chromen-5-yl)oxy]-3,7-dimethylocta-2,7-dien-4-yl}oxy)sulfonic acid details
5-[(4,6-dihydroxy-3,7-dimethylocta-2,7-dien-1-yl)oxy]-7-methoxy-2H-chromen-2-one → ({5-hydroxy-8-[(7-methoxy-2-oxo-2H-chromen-5-yl)oxy]-2,6-dimethylocta-1,6-dien-3-yl}oxy)sulfonic acid details
5-{[6-hydroxy-3-methyl-6-(2-methyloxiran-2-yl)hex-2-en-1-yl]oxy}-7-methoxy-2H-chromen-2-one → ({6-[(7-methoxy-2-oxo-2H-chromen-5-yl)oxy]-4-methyl-1-(2-methyloxiran-2-yl)hex-4-en-1-yl}oxy)sulfonic acid details
5-{[3-(3-hydroxy-4-methylpent-4-en-1-yl)-3-methyloxiran-2-yl]methoxy}-7-methoxy-2H-chromen-2-one → {[5-(3-{[(7-methoxy-2-oxo-2H-chromen-5-yl)oxy]methyl}-2-methyloxiran-2-yl)-2-methylpent-1-en-3-yl]oxy}sulfonic acid details
Hydroxypropanedioic acid → 2-(sulfooxy)propanedioic acid details
4-(hydroxymethyl)-2-oxo-2H-chromen-7-yl acetate → {[7-(acetyloxy)-2-oxo-2H-chromen-4-yl]methoxy}sulfonic acid details
4-methyl-2-oxo-2H-chromen-7-yl 2-hydroxyacetate → {2-[(4-methyl-2-oxo-2H-chromen-7-yl)oxy]-2-oxoethoxy}sulfonic acid details
7-hydroxy-4-(hydroxymethyl)-2H-chromen-2-one → [(7-hydroxy-2-oxo-2H-chromen-4-yl)methoxy]sulfonic acid details
7-hydroxy-6-(hydroxymethyl)-2H-chromen-2-one → [(7-hydroxy-2-oxo-2H-chromen-6-yl)methoxy]sulfonic acid details
6-(hydroxymethyl)-7-methoxy-2H-chromen-2-one → [(7-methoxy-2-oxo-2H-chromen-6-yl)methoxy]sulfonic acid details
6-[3,4-dihydroxy-6-(hydroxymethyl)-5-methoxyoxan-2-yl]-2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-4H-chromen-4-one → ({6-[2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-4-oxo-4H-chromen-6-yl]-4,5-dihydroxy-3-methoxyoxan-2-yl}methoxy)sulfonic acid details
6-[3,4-dihydroxy-6-(hydroxymethyl)-5-methoxyoxan-2-yl]-2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-4H-chromen-4-one → {2-[2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-4-oxo-4H-chromen-6-yl]-3-hydroxy-6-(hydroxymethyl)-5-methoxyoxan-4-yl}oxidanesulfonic acid details
6-[3,4-dihydroxy-6-(hydroxymethyl)-5-methoxyoxan-2-yl]-2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-4H-chromen-4-one → {2-[2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-4-oxo-4H-chromen-6-yl]-4-hydroxy-6-(hydroxymethyl)-5-methoxyoxan-3-yl}oxidanesulfonic acid details
6-[3,4-dihydroxy-6-(hydroxymethyl)-5-methoxyoxan-2-yl]-5,7-dihydroxy-2-(2,4,5-trihydroxyphenyl)-4H-chromen-4-one → ({6-[5,7-dihydroxy-4-oxo-2-(2,4,5-trihydroxyphenyl)-4H-chromen-6-yl]-4,5-dihydroxy-3-methoxyoxan-2-yl}methoxy)sulfonic acid details
6-[3,4-dihydroxy-6-(hydroxymethyl)-5-methoxyoxan-2-yl]-5,7-dihydroxy-2-(2,4,5-trihydroxyphenyl)-4H-chromen-4-one → {2-[5,7-dihydroxy-4-oxo-2-(2,4,5-trihydroxyphenyl)-4H-chromen-6-yl]-3-hydroxy-6-(hydroxymethyl)-5-methoxyoxan-4-yl}oxidanesulfonic acid details
6-[3,4-dihydroxy-6-(hydroxymethyl)-5-methoxyoxan-2-yl]-5,7-dihydroxy-2-(2,4,5-trihydroxyphenyl)-4H-chromen-4-one → {2-[5,7-dihydroxy-4-oxo-2-(2,4,5-trihydroxyphenyl)-4H-chromen-6-yl]-4-hydroxy-6-(hydroxymethyl)-5-methoxyoxan-3-yl}oxidanesulfonic acid details
6-[3,4-dihydroxy-6-(hydroxymethyl)-5-methoxyoxan-2-yl]-5,7-dihydroxy-2-(3-hydroxyphenyl)-4H-chromen-4-one → ({6-[5,7-dihydroxy-2-(3-hydroxyphenyl)-4-oxo-4H-chromen-6-yl]-4,5-dihydroxy-3-methoxyoxan-2-yl}methoxy)sulfonic acid details
6-[3,4-dihydroxy-6-(hydroxymethyl)-5-methoxyoxan-2-yl]-5,7-dihydroxy-2-(3-hydroxyphenyl)-4H-chromen-4-one → {2-[5,7-dihydroxy-2-(3-hydroxyphenyl)-4-oxo-4H-chromen-6-yl]-3-hydroxy-6-(hydroxymethyl)-5-methoxyoxan-4-yl}oxidanesulfonic acid details
6-[3,4-dihydroxy-6-(hydroxymethyl)-5-methoxyoxan-2-yl]-5,7-dihydroxy-2-(3-hydroxyphenyl)-4H-chromen-4-one → {2-[5,7-dihydroxy-2-(3-hydroxyphenyl)-4-oxo-4H-chromen-6-yl]-4-hydroxy-6-(hydroxymethyl)-5-methoxyoxan-3-yl}oxidanesulfonic acid details
3-(2-hydroxy-4-methoxyphenyl)-3,4-dihydro-2H-1-benzopyran-4,7-diol → [7-hydroxy-3-(2-hydroxy-4-methoxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-yl]oxidanesulfonic acid details
Hovenitin I → [2-(3,4-dihydroxy-5-methoxyphenyl)-5,7-dihydroxy-4-oxo-3,4-dihydro-2H-1-benzopyran-3-yl]oxidanesulfonic acid details
3,5,7-trihydroxy-2-(3-hydroxy-5-methoxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-one → [5,7-dihydroxy-2-(3-hydroxy-5-methoxyphenyl)-4-oxo-3,4-dihydro-2H-1-benzopyran-3-yl]oxidanesulfonic acid details
3-hydroxy-4-methoxy-6-[(E)-2-(4-methoxyphenyl)ethenyl]oxan-2-one → {4-methoxy-6-[(E)-2-(4-methoxyphenyl)ethenyl]-2-oxooxan-3-yl}oxidanesulfonic acid details
4-hydroxy-6-[(E)-2-(4-methoxyphenyl)ethenyl]oxan-2-one → {2-[(E)-2-(4-methoxyphenyl)ethenyl]-6-oxooxan-4-yl}oxidanesulfonic acid details
6-[1-hydroxy-2-(4-methoxyphenyl)ethyl]-4-methoxy-2H-pyran-2-one → [1-(4-methoxy-2-oxo-2H-pyran-6-yl)-2-(4-methoxyphenyl)ethoxy]sulfonic acid details
6-[2-hydroxy-2-(4-methoxyphenyl)ethyl]-4-methoxy-2H-pyran-2-one → [2-(4-methoxy-2-oxo-2H-pyran-6-yl)-1-(4-methoxyphenyl)ethoxy]sulfonic acid details
3-(3,4-dihydroxyphenyl)-3-hydroxy-N-[2-(4-hydroxyphenyl)ethyl]propanimidic acid → 3-(3,4-dihydroxyphenyl)-N-[2-(4-hydroxyphenyl)ethyl]-3-(sulfooxy)propanimidic acid details
3-(3,4-dihydroxyphenyl)-2-hydroxy-N-[2-(4-hydroxyphenyl)ethyl]propanimidic acid → 3-(3,4-dihydroxyphenyl)-N-[2-(4-hydroxyphenyl)ethyl]-2-(sulfooxy)propanimidic acid details
Theaflavate B → {2-[8-({[2-(3,4-dihydroxyphenyl)-6,7-dihydroxy-3,4-dihydro-2H-1-benzopyran-3-yl]oxy}carbonyl)-3,4,6-trihydroxy-5-oxo-5H-benzo[7]annulen-1-yl]-5,7-dihydroxy-3,4-dihydro-2H-1-benzopyran-3-yl}oxidanesulfonic acid details
Theaflavic acid → 1-[5,7-dihydroxy-3-(sulfooxy)-3,4-dihydro-2H-1-benzopyran-2-yl]-3,4,6-trihydroxy-5-oxo-5H-benzo[7]annulene-8-carboxylic acid details
Kanzonol Z → {2-[4-hydroxy-3-(3-methylbut-2-en-1-yl)phenyl]-8,8-dimethyl-4-oxo-2H,3H,4H,8H-pyrano[2,3-f]chromen-3-yl}oxidanesulfonic acid details
3,5,7-trihydroxy-2-(2,3,4,5-tetrahydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-one → [5,7-dihydroxy-4-oxo-2-(2,3,4,5-tetrahydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-3-yl]oxidanesulfonic acid details
2-[(4-hydroxyphenyl)methylidene]-2,3-dihydro-1-benzofuran-3,6-diol → {6-hydroxy-2-[(4-hydroxyphenyl)methylidene]-2,3-dihydro-1-benzofuran-3-yl}oxidanesulfonic acid details
2-(phenylmethylidene)-2,3-dihydro-1-benzofuran-3,6-diol → [6-hydroxy-2-(phenylmethylidene)-2,3-dihydro-1-benzofuran-3-yl]oxidanesulfonic acid details
4-[8-(1,2-dihydroxypropan-2-yl)-2-oxo-2H,8H,9H-furo[2,3-h]chromen-9-yl]-1-hydroxy-3,5,6-trimethoxy-10-methyl-9,10-dihydroacridin-9-one → {2-hydroxy-2-[9-(1-hydroxy-3,5,6-trimethoxy-10-methyl-9-oxo-9,10-dihydroacridin-4-yl)-2-oxo-2H,8H,9H-furo[2,3-h]chromen-8-yl]propoxy}sulfonic acid details
5,7-dihydroxy-3-(3-hydroxy-4-methoxyphenyl)-3-(hydroxymethyl)-3,4-dihydro-2H-1-benzopyran-4-one → {[5,7-dihydroxy-3-(3-hydroxy-4-methoxyphenyl)-4-oxo-3,4-dihydro-2H-1-benzopyran-3-yl]methoxy}sulfonic acid details
3-hydroxy-2-(3-hydroxy-4-methoxyphenyl)-2-methyl-1-(2,4,6-trihydroxyphenyl)propan-1-one → [2-(3-hydroxy-4-methoxyphenyl)-2-methyl-3-oxo-3-(2,4,6-trihydroxyphenyl)propoxy]sulfonic acid details
3-hydroxy-2-(3-hydroxy-4-methoxyphenyl)-2-methylpropanoic acid → 2-(3-hydroxy-4-methoxyphenyl)-2-methyl-3-(sulfooxy)propanoic acid details
4',5,7,8'-tetrahydroxy-3'-methoxy-2,4-dihydrospiro[1-benzopyran-3,7'-bicyclo[4.2.0]octane]-1',3',5'-trien-4-one → {4',5,7-trihydroxy-3'-methoxy-4-oxo-2,4-dihydrospiro[1-benzopyran-3,7'-bicyclo[4.2.0]octane]-1',3',5'-trien-8'-yl}oxidanesulfonic acid details
8,16-dihydroxy-6-(6-hydroxy-1-benzofuran-2-yl)-12-(hydroxymethyl)-3,13-dioxapentacyclo[10.7.1.0²,¹⁰.0⁴,⁹.0¹⁴,¹⁹]icosa-2(10),4,6,8,14(19),15,17-heptaen-11-one → {[8,16-dihydroxy-6-(6-hydroxy-1-benzofuran-2-yl)-11-oxo-3,13-dioxapentacyclo[10.7.1.0²,¹⁰.0⁴,⁹.0¹⁴,¹⁹]icosa-2(10),4,6,8,14(19),15,17-heptaen-12-yl]methoxy}sulfonic acid details
Foetidin → (1,1,4a-trimethyl-6-methylidene-5-{[(2-oxo-2H-chromen-4-yl)oxy]methyl}-decahydronaphthalen-2-yl)oxidanesulfonic acid details
4-[(3,6-dihydroxy-5,5,8a-trimethyl-2-methylidene-decahydronaphthalen-1-yl)methoxy]-2H-chromen-2-one → (7-hydroxy-4a,8,8-trimethyl-3-methylidene-4-{[(2-oxo-2H-chromen-4-yl)oxy]methyl}-decahydronaphthalen-2-yl)oxidanesulfonic acid details
4-[(3,6-dihydroxy-5,5,8a-trimethyl-2-methylidene-decahydronaphthalen-1-yl)methoxy]-2H-chromen-2-one → (7-hydroxy-1,1,4a-trimethyl-6-methylidene-5-{[(2-oxo-2H-chromen-4-yl)oxy]methyl}-decahydronaphthalen-2-yl)oxidanesulfonic acid details
4-[(1,6-dihydroxy-5,5,8a-trimethyl-2-methylidene-decahydronaphthalen-1-yl)methoxy]-2H-chromen-2-one → (5-hydroxy-1,1,4a-trimethyl-6-methylidene-5-{[(2-oxo-2H-chromen-4-yl)oxy]methyl}-decahydronaphthalen-2-yl)oxidanesulfonic acid details
6-hydroxy-4-[(6-hydroxy-5,5,8a-trimethyl-2-methylidene-decahydronaphthalen-1-yl)methoxy]-2H-chromen-2-one → (5-{[(6-hydroxy-2-oxo-2H-chromen-4-yl)oxy]methyl}-1,1,4a-trimethyl-6-methylidene-decahydronaphthalen-2-yl)oxidanesulfonic acid details
7-hydroxy-4-[(6-hydroxy-5,5,8a-trimethyl-2-methylidene-decahydronaphthalen-1-yl)methoxy]-2H-chromen-2-one → (5-{[(7-hydroxy-2-oxo-2H-chromen-4-yl)oxy]methyl}-1,1,4a-trimethyl-6-methylidene-decahydronaphthalen-2-yl)oxidanesulfonic acid details
6-hydroxy-5,5,8a-trimethyl-2-methylidene-decahydronaphthalene-1-carbaldehyde → (5-formyl-1,1,4a-trimethyl-6-methylidene-decahydronaphthalen-2-yl)oxidanesulfonic acid details
4-[(4a,6-dihydroxy-5,5,8a-trimethyl-2-methylidene-decahydronaphthalen-1-yl)methoxy]-2H-chromen-2-one → (8a-hydroxy-1,1,4a-trimethyl-6-methylidene-5-{[(2-oxo-2H-chromen-4-yl)oxy]methyl}-decahydronaphthalen-2-yl)oxidanesulfonic acid details
4-[(4,6-dihydroxy-5,5,8a-trimethyl-2-methylidene-decahydronaphthalen-1-yl)methoxy]-2H-chromen-2-one → (7-hydroxy-4a,8,8-trimethyl-3-methylidene-4-{[(2-oxo-2H-chromen-4-yl)oxy]methyl}-decahydronaphthalen-1-yl)oxidanesulfonic acid details
4-[(4,6-dihydroxy-5,5,8a-trimethyl-2-methylidene-decahydronaphthalen-1-yl)methoxy]-2H-chromen-2-one → (8-hydroxy-1,1,4a-trimethyl-6-methylidene-5-{[(2-oxo-2H-chromen-4-yl)oxy]methyl}-decahydronaphthalen-2-yl)oxidanesulfonic acid details
4-[(6,8-dihydroxy-5,5,8a-trimethyl-2-methylidene-decahydronaphthalen-1-yl)methoxy]-2H-chromen-2-one → (3-hydroxy-4,4,8a-trimethyl-7-methylidene-8-{[(2-oxo-2H-chromen-4-yl)oxy]methyl}-decahydronaphthalen-1-yl)oxidanesulfonic acid details
4-[(6,8-dihydroxy-5,5,8a-trimethyl-2-methylidene-decahydronaphthalen-1-yl)methoxy]-2H-chromen-2-one → (4-hydroxy-1,1,4a-trimethyl-6-methylidene-5-{[(2-oxo-2H-chromen-4-yl)oxy]methyl}-decahydronaphthalen-2-yl)oxidanesulfonic acid details
4-[(6,7-dihydroxy-5,5,8a-trimethyl-2-methylidene-decahydronaphthalen-1-yl)methoxy]-2H-chromen-2-one → (3-hydroxy-4,4,8a-trimethyl-7-methylidene-8-{[(2-oxo-2H-chromen-4-yl)oxy]methyl}-decahydronaphthalen-2-yl)oxidanesulfonic acid details
4-[(6,7-dihydroxy-5,5,8a-trimethyl-2-methylidene-decahydronaphthalen-1-yl)methoxy]-2H-chromen-2-one → (3-hydroxy-1,1,4a-trimethyl-6-methylidene-5-{[(2-oxo-2H-chromen-4-yl)oxy]methyl}-decahydronaphthalen-2-yl)oxidanesulfonic acid details
8-hydroxy-4-[(6-hydroxy-5,5,8a-trimethyl-2-methylidene-decahydronaphthalen-1-yl)methoxy]-2H-chromen-2-one → (5-{[(8-hydroxy-2-oxo-2H-chromen-4-yl)oxy]methyl}-1,1,4a-trimethyl-6-methylidene-decahydronaphthalen-2-yl)oxidanesulfonic acid details
5-hydroxy-4-[(6-hydroxy-5,5,8a-trimethyl-2-methylidene-decahydronaphthalen-1-yl)methoxy]-2H-chromen-2-one → (5-{[(5-hydroxy-2-oxo-2H-chromen-4-yl)oxy]methyl}-1,1,4a-trimethyl-6-methylidene-decahydronaphthalen-2-yl)oxidanesulfonic acid details
4-{[6-hydroxy-8a-(hydroxymethyl)-5,5-dimethyl-2-methylidene-decahydronaphthalen-1-yl]methoxy}-2H-chromen-2-one → [(2-hydroxy-1,1-dimethyl-6-methylidene-5-{[(2-oxo-2H-chromen-4-yl)oxy]methyl}-decahydronaphthalen-4a-yl)methoxy]sulfonic acid details
4-{[6-hydroxy-8a-(hydroxymethyl)-5,5-dimethyl-2-methylidene-decahydronaphthalen-1-yl]methoxy}-2H-chromen-2-one → [4a-(hydroxymethyl)-1,1-dimethyl-6-methylidene-5-{[(2-oxo-2H-chromen-4-yl)oxy]methyl}-decahydronaphthalen-2-yl]oxidanesulfonic acid details
4-{[6-hydroxy-5-(hydroxymethyl)-5,8a-dimethyl-2-methylidene-decahydronaphthalen-1-yl]methoxy}-2H-chromen-2-one → [(2-hydroxy-1,4a-dimethyl-6-methylidene-5-{[(2-oxo-2H-chromen-4-yl)oxy]methyl}-decahydronaphthalen-1-yl)methoxy]sulfonic acid details
4-{[6-hydroxy-5-(hydroxymethyl)-5,8a-dimethyl-2-methylidene-decahydronaphthalen-1-yl]methoxy}-2H-chromen-2-one → [1-(hydroxymethyl)-1,4a-dimethyl-6-methylidene-5-{[(2-oxo-2H-chromen-4-yl)oxy]methyl}-decahydronaphthalen-2-yl]oxidanesulfonic acid details
Guavin B → [13-(4-benzoyl-3,5-dihydroxyphenoxy)-3,4,5,12,21,22,23-heptahydroxy-8,18-dioxo-9,14,17-trioxatetracyclo[17.4.0.0²,⁷.0¹⁰,¹⁵]tricosa-1(23),2,4,6,19,21-hexaen-11-yl]oxidanesulfonic acid details
Guavin B → [13-(4-benzoyl-3,5-dihydroxyphenoxy)-3,4,5,11,21,22,23-heptahydroxy-8,18-dioxo-9,14,17-trioxatetracyclo[17.4.0.0²,⁷.0¹⁰,¹⁵]tricosa-1(23),2,4,6,19,21-hexaen-12-yl]oxidanesulfonic acid details
13-(3,5-dihydroxyphenoxy)-3,4,5,11,12,21,22,23-octahydroxy-9,14,17-trioxatetracyclo[17.4.0.0²,⁷.0¹⁰,¹⁵]tricosa-1(23),2,4,6,19,21-hexaene-8,18-dione → [13-(3,5-dihydroxyphenoxy)-3,4,5,12,21,22,23-heptahydroxy-8,18-dioxo-9,14,17-trioxatetracyclo[17.4.0.0²,⁷.0¹⁰,¹⁵]tricosa-1(23),2,4,6,19,21-hexaen-11-yl]oxidanesulfonic acid details
13-(3,5-dihydroxyphenoxy)-3,4,5,11,12,21,22,23-octahydroxy-9,14,17-trioxatetracyclo[17.4.0.0²,⁷.0¹⁰,¹⁵]tricosa-1(23),2,4,6,19,21-hexaene-8,18-dione → [13-(3,5-dihydroxyphenoxy)-3,4,5,11,21,22,23-heptahydroxy-8,18-dioxo-9,14,17-trioxatetracyclo[17.4.0.0²,⁷.0¹⁰,¹⁵]tricosa-1(23),2,4,6,19,21-hexaen-12-yl]oxidanesulfonic acid details
Junosmarin → {8,8-dimethyl-9-[(3-methylbutanoyl)oxy]-2-oxo-2H,8H,9H,10H-pyrano[2,3-h]chromen-10-yl}oxidanesulfonic acid details
9,10-dihydroxy-8,8-dimethyl-2H,8H,9H,10H-pyrano[2,3-h]chromen-2-one → {10-hydroxy-8,8-dimethyl-2-oxo-2H,8H,9H,10H-pyrano[2,3-h]chromen-9-yl}oxidanesulfonic acid details
9,10-dihydroxy-8,8-dimethyl-2H,8H,9H,10H-pyrano[2,3-h]chromen-2-one → {9-hydroxy-8,8-dimethyl-2-oxo-2H,8H,9H,10H-pyrano[2,3-h]chromen-10-yl}oxidanesulfonic acid details
10-hydroxy-8,8-dimethyl-2-oxo-2H,8H,9H,10H-pyrano[2,3-h]chromen-9-yl 3-hydroxy-3-methylbutanoate → {9-[(3-hydroxy-3-methylbutanoyl)oxy]-8,8-dimethyl-2-oxo-2H,8H,9H,10H-pyrano[2,3-h]chromen-10-yl}oxidanesulfonic acid details
10-hydroxy-8,8-dimethyl-2-oxo-2H,8H,9H,10H-pyrano[2,3-h]chromen-9-yl 4-hydroxy-3-methylbutanoate → [4-({10-hydroxy-8,8-dimethyl-2-oxo-2H,8H,9H,10H-pyrano[2,3-h]chromen-9-yl}oxy)-2-methyl-4-oxobutoxy]sulfonic acid details
10-hydroxy-8,8-dimethyl-2-oxo-2H,8H,9H,10H-pyrano[2,3-h]chromen-9-yl 4-hydroxy-3-methylbutanoate → {9-[(4-hydroxy-3-methylbutanoyl)oxy]-8,8-dimethyl-2-oxo-2H,8H,9H,10H-pyrano[2,3-h]chromen-10-yl}oxidanesulfonic acid details
10-hydroxy-8,8-dimethyl-2-oxo-2H,8H,9H,10H-pyrano[2,3-h]chromen-9-yl 3-methylbut-3-enoate → {8,8-dimethyl-9-[(3-methylbut-3-enoyl)oxy]-2-oxo-2H,8H,9H,10H-pyrano[2,3-h]chromen-10-yl}oxidanesulfonic acid details
10-hydroxy-8,8-dimethyl-2-oxo-2H,8H,9H,10H-pyrano[2,3-h]chromen-9-yl 2-hydroxy-3-methylbutanoate → {[1-({10-hydroxy-8,8-dimethyl-2-oxo-2H,8H,9H,10H-pyrano[2,3-h]chromen-9-yl}oxy)-3-methyl-1-oxobutan-2-yl]oxy}sulfonic acid details
10-hydroxy-8,8-dimethyl-2-oxo-2H,8H,9H,10H-pyrano[2,3-h]chromen-9-yl 2-hydroxy-3-methylbutanoate → {9-[(2-hydroxy-3-methylbutanoyl)oxy]-8,8-dimethyl-2-oxo-2H,8H,9H,10H-pyrano[2,3-h]chromen-10-yl}oxidanesulfonic acid details
9,10-dihydroxy-8-(hydroxymethyl)-8-methyl-2H,8H,9H,10H-pyrano[2,3-h]chromen-2-one → ({9,10-dihydroxy-8-methyl-2-oxo-2H,8H,9H,10H-pyrano[2,3-h]chromen-8-yl}methoxy)sulfonic acid details
9,10-dihydroxy-8-(hydroxymethyl)-8-methyl-2H,8H,9H,10H-pyrano[2,3-h]chromen-2-one → [10-hydroxy-8-(hydroxymethyl)-8-methyl-2-oxo-2H,8H,9H,10H-pyrano[2,3-h]chromen-9-yl]oxidanesulfonic acid details
9,10-dihydroxy-8-(hydroxymethyl)-8-methyl-2H,8H,9H,10H-pyrano[2,3-h]chromen-2-one → [9-hydroxy-8-(hydroxymethyl)-8-methyl-2-oxo-2H,8H,9H,10H-pyrano[2,3-h]chromen-10-yl]oxidanesulfonic acid details
6-hydroxy-5-methoxy-1,7-diphenylheptan-3-one → [(3-methoxy-5-oxo-1,7-diphenylheptan-2-yl)oxy]sulfonic acid details
1-hydroxy-5-methoxy-1,7-diphenylheptan-3-one → [(5-methoxy-3-oxo-1,7-diphenylheptyl)oxy]sulfonic acid details
7-hydroxy-5-methoxy-1,7-diphenylheptan-3-one → [(3-methoxy-5-oxo-1,7-diphenylheptyl)oxy]sulfonic acid details
2-hydroxy-5-methoxy-1,7-diphenylheptan-3-one → [(5-methoxy-3-oxo-1,7-diphenylheptan-2-yl)oxy]sulfonic acid details
4-hydroxy-5-methoxy-1,7-diphenylheptan-3-one → [(3-methoxy-5-oxo-1,7-diphenylheptan-4-yl)oxy]sulfonic acid details
5-methoxy-1,7-diphenylheptan-3-ol → [(5-methoxy-1,7-diphenylheptan-3-yl)oxy]sulfonic acid details
6-hydroxy-7-(4-hydroxyphenyl)-5-methoxy-1-phenylheptan-3-one → {[1-(4-hydroxyphenyl)-3-methoxy-5-oxo-7-phenylheptan-2-yl]oxy}sulfonic acid details
1-hydroxy-7-(4-hydroxyphenyl)-5-methoxy-1-phenylheptan-3-one → {[7-(4-hydroxyphenyl)-5-methoxy-3-oxo-1-phenylheptyl]oxy}sulfonic acid details
7-hydroxy-7-(4-hydroxyphenyl)-5-methoxy-1-phenylheptan-3-one → {[1-(4-hydroxyphenyl)-3-methoxy-5-oxo-7-phenylheptyl]oxy}sulfonic acid details
2-hydroxy-7-(4-hydroxyphenyl)-5-methoxy-1-phenylheptan-3-one → {[7-(4-hydroxyphenyl)-5-methoxy-3-oxo-1-phenylheptan-2-yl]oxy}sulfonic acid details
4-hydroxy-7-(4-hydroxyphenyl)-5-methoxy-1-phenylheptan-3-one → {[1-(4-hydroxyphenyl)-3-methoxy-5-oxo-7-phenylheptan-4-yl]oxy}sulfonic acid details
4-(5-hydroxy-3-methoxy-7-phenylheptyl)phenol → {[7-(4-hydroxyphenyl)-5-methoxy-1-phenylheptan-3-yl]oxy}sulfonic acid details
5-Hydroxy-7-(4-hydroxyphenyl)-1-phenyl-3-heptanone → {[1-(4-hydroxyphenyl)-5-oxo-7-phenylheptan-3-yl]oxy}sulfonic acid details
(4E)-6-hydroxy-7-(4-hydroxyphenyl)-1-phenylhept-4-en-3-one → {[(3E)-1-(4-hydroxyphenyl)-5-oxo-7-phenylhept-3-en-2-yl]oxy}sulfonic acid details
(4E)-7-hydroxy-7-(4-hydroxyphenyl)-1-phenylhept-4-en-3-one → {[(3E)-1-(4-hydroxyphenyl)-5-oxo-7-phenylhept-3-en-1-yl]oxy}sulfonic acid details
(4E)-1-hydroxy-7-(4-hydroxyphenyl)-1-phenylhept-4-en-3-one → {[(4E)-7-(4-hydroxyphenyl)-3-oxo-1-phenylhept-4-en-1-yl]oxy}sulfonic acid details
(4E)-2-hydroxy-7-(4-hydroxyphenyl)-1-phenylhept-4-en-3-one → {[(4E)-7-(4-hydroxyphenyl)-3-oxo-1-phenylhept-4-en-2-yl]oxy}sulfonic acid details
4-[(3E)-5-hydroxy-7-phenylhept-3-en-1-yl]phenol → {[(4E)-7-(4-hydroxyphenyl)-1-phenylhept-4-en-3-yl]oxy}sulfonic acid details
6-hydroxy-7-(4-hydroxyphenyl)-1-phenylheptan-3-one → {[1-(4-hydroxyphenyl)-5-oxo-7-phenylheptan-2-yl]oxy}sulfonic acid details
7-hydroxy-7-(4-hydroxyphenyl)-1-phenylheptan-3-one → {[1-(4-hydroxyphenyl)-5-oxo-7-phenylheptyl]oxy}sulfonic acid details
1-hydroxy-7-(4-hydroxyphenyl)-1-phenylheptan-3-one → {[7-(4-hydroxyphenyl)-3-oxo-1-phenylheptyl]oxy}sulfonic acid details
2-hydroxy-7-(4-hydroxyphenyl)-1-phenylheptan-3-one → {[7-(4-hydroxyphenyl)-3-oxo-1-phenylheptan-2-yl]oxy}sulfonic acid details
4-hydroxy-7-(4-hydroxyphenyl)-1-phenylheptan-3-one → {[7-(4-hydroxyphenyl)-3-oxo-1-phenylheptan-4-yl]oxy}sulfonic acid details
4-(5-hydroxy-7-phenylheptyl)phenol → {[7-(4-hydroxyphenyl)-1-phenylheptan-3-yl]oxy}sulfonic acid details
2-[6-(2,4-dihydroxybenzoyl)-5-(2,4-dihydroxyphenyl)-3-(hydroxymethyl)cyclohex-2-en-1-yl]-5-[(E)-2-(2,4-dihydroxyphenyl)ethenyl]benzene-1,3-diol → {[4-(2,4-dihydroxybenzoyl)-5-(2,4-dihydroxyphenyl)-3-{4-[(E)-2-(2,4-dihydroxyphenyl)ethenyl]-2,6-dihydroxyphenyl}cyclohex-1-en-1-yl]methoxy}sulfonic acid details
2-[6-(2,4-dihydroxybenzoyl)-5-(2,4-dihydroxyphenyl)-4-hydroxy-3-methylcyclohex-2-en-1-yl]-5-[(E)-2-(2,4-dihydroxyphenyl)ethenyl]benzene-1,3-diol → [5-(2,4-dihydroxybenzoyl)-6-(2,4-dihydroxyphenyl)-4-{4-[(E)-2-(2,4-dihydroxyphenyl)ethenyl]-2,6-dihydroxyphenyl}-2-methylcyclohex-2-en-1-yl]oxidanesulfonic acid details
4-(2,4-dihydroxyphenyl)-8-[(E)-2-(2,4-dihydroxyphenyl)ethenyl]-10,18-dihydroxy-14-(hydroxymethyl)-3,5,15-trioxahexacyclo[12.7.1.0²,⁴.0²,¹².0⁶,¹¹.0¹⁶,²¹]docosa-6,8,10,16(21),17,19-hexaen-13-one → {[4-(2,4-dihydroxyphenyl)-8-[(E)-2-(2,4-dihydroxyphenyl)ethenyl]-10,18-dihydroxy-13-oxo-3,5,15-trioxahexacyclo[12.7.1.0²,⁴.0²,¹².0⁶,¹¹.0¹⁶,²¹]docosa-6,8,10,16(21),17,19-hexaen-14-yl]methoxy}sulfonic acid details
7-hydroxy-3-[hydroxy(3-hydroxy-4-methoxyphenyl)methyl]-5-methoxy-3,4-dihydro-2H-1-benzopyran-4-one → [(3-hydroxy-4-methoxyphenyl)(7-hydroxy-5-methoxy-4-oxo-3,4-dihydro-2H-1-benzopyran-3-yl)methoxy]sulfonic acid details
4-hydroxy-3-{[4-hydroxy-5-(hydroxymethyl)-2-oxo-2H-chromen-3-yl]methyl}-5-methyl-2H-chromen-2-one → ({4-hydroxy-3-[(4-hydroxy-5-methyl-2-oxo-2H-chromen-3-yl)methyl]-2-oxo-2H-chromen-5-yl}methoxy)sulfonic acid details
5-(6-hydroxy-1-benzofuran-2-yl)-2-[(2E)-4-hydroxy-3-methylbut-2-en-1-yl]benzene-1,3-diol → {[(2E)-4-[2,6-dihydroxy-4-(6-hydroxy-1-benzofuran-2-yl)phenyl]-2-methylbut-2-en-1-yl]oxy}sulfonic acid details
5-(6-hydroxy-1-benzofuran-2-yl)-2-(4-hydroxy-3-methylbut-2-en-1-yl)benzene-1,3-diol → ({4-[2,6-dihydroxy-4-(6-hydroxy-1-benzofuran-2-yl)phenyl]-2-methylbut-2-en-1-yl}oxy)sulfonic acid details
2-[5-hydroxy-2-(4-hydroxy-3-methylbut-2-en-1-yl)-3-methoxyphenyl]-1-benzofuran-6-ol → ({4-[4-hydroxy-2-(6-hydroxy-1-benzofuran-2-yl)-6-methoxyphenyl]-2-methylbut-2-en-1-yl}oxy)sulfonic acid details
7-(6-hydroxy-1-benzofuran-2-yl)-2-(hydroxymethyl)-2-methyl-2H-chromen-5-ol → {[5-hydroxy-7-(6-hydroxy-1-benzofuran-2-yl)-2-methyl-2H-chromen-2-yl]methoxy}sulfonic acid details
5-(6-hydroxy-1-benzofuran-2-yl)-2-(hydroxymethyl)-2-methyl-2H-chromen-7-ol → {[7-hydroxy-5-(6-hydroxy-1-benzofuran-2-yl)-2-methyl-2H-chromen-2-yl]methoxy}sulfonic acid details
5-[12-(hydroxymethyl)-3,10-dioxatricyclo[7.5.0.0²,⁶]tetradeca-1(9),2(6),4,7,12-pentaen-4-yl]benzene-1,3-diol → {[4-(3,5-dihydroxyphenyl)-3,10-dioxatricyclo[7.5.0.0²,⁶]tetradeca-1(9),2(6),4,7,12-pentaen-12-yl]methoxy}sulfonic acid details
5-[12-(hydroxymethyl)-7-methoxy-3,10-dioxatricyclo[7.5.0.0²,⁶]tetradeca-1(9),2(6),4,7,12-pentaen-4-yl]benzene-1,3-diol → {[4-(3,5-dihydroxyphenyl)-7-methoxy-3,10-dioxatricyclo[7.5.0.0²,⁶]tetradeca-1(9),2(6),4,7,12-pentaen-12-yl]methoxy}sulfonic acid details
3-[7-methoxy-3-methyl-2-(3,4,5-trimethoxyphenyl)-2,3-dihydro-1-benzofuran-5-yl]prop-2-en-1-ol → ({3-[7-methoxy-3-methyl-2-(3,4,5-trimethoxyphenyl)-2,3-dihydro-1-benzofuran-5-yl]prop-2-en-1-yl}oxy)sulfonic acid details
[7-methoxy-5-(prop-1-en-1-yl)-2-(3,4,5-trimethoxyphenyl)-2,3-dihydro-1-benzofuran-3-yl]methanol → {[7-methoxy-5-(prop-1-en-1-yl)-2-(3,4,5-trimethoxyphenyl)-2,3-dihydro-1-benzofuran-3-yl]methoxy}sulfonic acid details
3,5-Dihydroxy-6,7-methylenedioxyflavanone → {2-hydroxy-13-oxo-11-phenyl-4,6,10-trioxatricyclo[7.4.0.0³,⁷]trideca-1,3(7),8-trien-12-yl}oxidanesulfonic acid details
2,12-dihydroxy-11-(3-hydroxyphenyl)-4,6,10-trioxatricyclo[7.4.0.0³,⁷]trideca-1,3(7),8-trien-13-one → [2-hydroxy-11-(3-hydroxyphenyl)-13-oxo-4,6,10-trioxatricyclo[7.4.0.0³,⁷]trideca-1,3(7),8-trien-12-yl]oxidanesulfonic acid details
2,12-dihydroxy-11-(4-hydroxyphenyl)-4,6,10-trioxatricyclo[7.4.0.0³,⁷]trideca-1,3(7),8-trien-13-one → [2-hydroxy-11-(4-hydroxyphenyl)-13-oxo-4,6,10-trioxatricyclo[7.4.0.0³,⁷]trideca-1,3(7),8-trien-12-yl]oxidanesulfonic acid details
2,12-dihydroxy-11-(2-hydroxyphenyl)-4,6,10-trioxatricyclo[7.4.0.0³,⁷]trideca-1,3(7),8-trien-13-one → [2-hydroxy-11-(2-hydroxyphenyl)-13-oxo-4,6,10-trioxatricyclo[7.4.0.0³,⁷]trideca-1,3(7),8-trien-12-yl]oxidanesulfonic acid details
Isosilychristin → {[7-hydroxy-2-(4-hydroxy-3-methoxyphenyl)-4-(3,5,7-trihydroxy-4-oxo-3,4-dihydro-2H-1-benzopyran-2-yl)-2,3-dihydro-1-benzofuran-3-yl]methoxy}sulfonic acid details
Isosilychristin → {5,7-dihydroxy-2-[7-hydroxy-2-(4-hydroxy-3-methoxyphenyl)-3-(hydroxymethyl)-2,3-dihydro-1-benzofuran-4-yl]-4-oxo-3,4-dihydro-2H-1-benzopyran-3-yl}oxidanesulfonic acid details
3,5,7-trihydroxy-2-[7-hydroxy-3-(hydroxymethyl)-2-(3-methoxyphenyl)-2,3-dihydro-1-benzofuran-4-yl]-3,4-dihydro-2H-1-benzopyran-4-one → {[7-hydroxy-2-(3-methoxyphenyl)-4-(3,5,7-trihydroxy-4-oxo-3,4-dihydro-2H-1-benzopyran-2-yl)-2,3-dihydro-1-benzofuran-3-yl]methoxy}sulfonic acid details
3,5,7-trihydroxy-2-[7-hydroxy-3-(hydroxymethyl)-2-(3-methoxyphenyl)-2,3-dihydro-1-benzofuran-4-yl]-3,4-dihydro-2H-1-benzopyran-4-one → {5,7-dihydroxy-2-[7-hydroxy-3-(hydroxymethyl)-2-(3-methoxyphenyl)-2,3-dihydro-1-benzofuran-4-yl]-4-oxo-3,4-dihydro-2H-1-benzopyran-3-yl}oxidanesulfonic acid details
Silyhermin → {[5-(5,7-dihydroxy-4-oxo-3,4-dihydro-2H-1-benzopyran-2-yl)-7-hydroxy-2-(4-hydroxy-3-methoxyphenyl)-2,3-dihydro-1-benzofuran-3-yl]methoxy}sulfonic acid details
2-[2-(3,4-dihydroxyphenyl)-7-hydroxy-3-(hydroxymethyl)-2,3-dihydro-1-benzofuran-5-yl]-5,7-dihydroxy-3,4-dihydro-2H-1-benzopyran-4-one → {[5-(5,7-dihydroxy-4-oxo-3,4-dihydro-2H-1-benzopyran-2-yl)-2-(3,4-dihydroxyphenyl)-7-hydroxy-2,3-dihydro-1-benzofuran-3-yl]methoxy}sulfonic acid details
2-[2-(3,4-dihydroxy-5-methoxyphenyl)-7-hydroxy-3-(hydroxymethyl)-2,3-dihydro-1-benzofuran-5-yl]-5,7-dihydroxy-3,4-dihydro-2H-1-benzopyran-4-one → {[5-(5,7-dihydroxy-4-oxo-3,4-dihydro-2H-1-benzopyran-2-yl)-2-(3,4-dihydroxy-5-methoxyphenyl)-7-hydroxy-2,3-dihydro-1-benzofuran-3-yl]methoxy}sulfonic acid details
5,6,7-trihydroxy-2-[7-hydroxy-2-(4-hydroxy-3-methoxyphenyl)-3-(hydroxymethyl)-2,3-dihydro-1-benzofuran-5-yl]-3,4-dihydro-2H-1-benzopyran-4-one → {[7-hydroxy-2-(4-hydroxy-3-methoxyphenyl)-5-(5,6,7-trihydroxy-4-oxo-3,4-dihydro-2H-1-benzopyran-2-yl)-2,3-dihydro-1-benzofuran-3-yl]methoxy}sulfonic acid details
2-[6,7-dihydroxy-2-(4-hydroxy-3-methoxyphenyl)-3-(hydroxymethyl)-2,3-dihydro-1-benzofuran-5-yl]-5,7-dihydroxy-3,4-dihydro-2H-1-benzopyran-4-one → {[5-(5,7-dihydroxy-4-oxo-3,4-dihydro-2H-1-benzopyran-2-yl)-6,7-dihydroxy-2-(4-hydroxy-3-methoxyphenyl)-2,3-dihydro-1-benzofuran-3-yl]methoxy}sulfonic acid details
5,7-dihydroxy-2-[7-hydroxy-3-(hydroxymethyl)-2-(3-methoxyphenyl)-2,3-dihydro-1-benzofuran-5-yl]-3,4-dihydro-2H-1-benzopyran-4-one → {[5-(5,7-dihydroxy-4-oxo-3,4-dihydro-2H-1-benzopyran-2-yl)-7-hydroxy-2-(3-methoxyphenyl)-2,3-dihydro-1-benzofuran-3-yl]methoxy}sulfonic acid details
5,7-dihydroxy-2-[7-hydroxy-3-(hydroxymethyl)-2-(3-hydroxyphenyl)-2,3-dihydro-1-benzofuran-5-yl]-3,4-dihydro-2H-1-benzopyran-4-one → {[5-(5,7-dihydroxy-4-oxo-3,4-dihydro-2H-1-benzopyran-2-yl)-7-hydroxy-2-(3-hydroxyphenyl)-2,3-dihydro-1-benzofuran-3-yl]methoxy}sulfonic acid details
5,7-dihydroxy-2-[7-hydroxy-2-(3-hydroxy-5-methoxyphenyl)-3-(hydroxymethyl)-2,3-dihydro-1-benzofuran-5-yl]-3,4-dihydro-2H-1-benzopyran-4-one → {[5-(5,7-dihydroxy-4-oxo-3,4-dihydro-2H-1-benzopyran-2-yl)-7-hydroxy-2-(3-hydroxy-5-methoxyphenyl)-2,3-dihydro-1-benzofuran-3-yl]methoxy}sulfonic acid details
5,6,7-trihydroxy-2-[7-hydroxy-3-(hydroxymethyl)-2-(3-methoxyphenyl)-2,3-dihydro-1-benzofuran-5-yl]-3,4-dihydro-2H-1-benzopyran-4-one → {[7-hydroxy-2-(3-methoxyphenyl)-5-(5,6,7-trihydroxy-4-oxo-3,4-dihydro-2H-1-benzopyran-2-yl)-2,3-dihydro-1-benzofuran-3-yl]methoxy}sulfonic acid details
2-[6,7-dihydroxy-3-(hydroxymethyl)-2-(3-methoxyphenyl)-2,3-dihydro-1-benzofuran-5-yl]-5,7-dihydroxy-3,4-dihydro-2H-1-benzopyran-4-one → {[5-(5,7-dihydroxy-4-oxo-3,4-dihydro-2H-1-benzopyran-2-yl)-6,7-dihydroxy-2-(3-methoxyphenyl)-2,3-dihydro-1-benzofuran-3-yl]methoxy}sulfonic acid details
Coriandrone C → ({4-methoxy-5-oxo-5H-furo[2,3-g]isochromen-7-yl}methoxy)sulfonic acid details
5-[(E)-2-{4-hydroxy-3-[(1E)-4-hydroxy-3-methylidenebut-1-en-1-yl]phenyl}ethenyl]benzene-1,3-diol → {[(3E)-4-{5-[(E)-2-(3,5-dihydroxyphenyl)ethenyl]-2-hydroxyphenyl}-2-methylidenebut-3-en-1-yl]oxy}sulfonic acid details
7,14-dihydroxy-15-(hydroxymethyl)-6-methoxy-4,12-dimethyl-5-(3-methylbut-2-enoyl)-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaen-10-one → {[7,14-dihydroxy-6-methoxy-4,12-dimethyl-5-(3-methylbut-2-enoyl)-10-oxo-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaen-15-yl]methoxy}sulfonic acid details
7,14-dihydroxy-4-(hydroxymethyl)-6-methoxy-12-methyl-5-(3-methylbut-2-enoyl)-10-oxo-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaene-15-carbaldehyde → {[15-formyl-7,14-dihydroxy-6-methoxy-12-methyl-5-(3-methylbut-2-enoyl)-10-oxo-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaen-4-yl]methoxy}sulfonic acid details
7,14-dihydroxy-12-(hydroxymethyl)-6-methoxy-4-methyl-5-(3-methylbut-2-enoyl)-10-oxo-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaene-15-carbaldehyde → {[15-formyl-7,14-dihydroxy-6-methoxy-4-methyl-5-(3-methylbut-2-enoyl)-10-oxo-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaen-12-yl]methoxy}sulfonic acid details
7,14-dihydroxy-15-(hydroxymethyl)-6-methoxy-4,12-dimethyl-5-(3-methylbutanoyl)-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaen-10-one → {[7,14-dihydroxy-6-methoxy-4,12-dimethyl-5-(3-methylbutanoyl)-10-oxo-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaen-15-yl]methoxy}sulfonic acid details
7,14-dihydroxy-4-(hydroxymethyl)-6-methoxy-12-methyl-5-(3-methylbut-2-enoyl)-10-oxo-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaene-15-carboxylic acid → 7,14-dihydroxy-6-methoxy-12-methyl-5-(3-methylbut-2-enoyl)-10-oxo-4-[(sulfooxy)methyl]-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaene-15-carboxylic acid details
7,14-dihydroxy-4-(hydroxymethyl)-6-methoxy-12-methyl-5-(3-methylbutanoyl)-10-oxo-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaene-15-carbaldehyde → {[15-formyl-7,14-dihydroxy-6-methoxy-12-methyl-5-(3-methylbutanoyl)-10-oxo-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaen-4-yl]methoxy}sulfonic acid details
7,14-dihydroxy-4-(hydroxymethyl)-6-methoxy-12-methyl-5-(3-methylbut-2-enoyl)-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaen-10-one → {[7,14-dihydroxy-6-methoxy-12-methyl-5-(3-methylbut-2-enoyl)-10-oxo-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaen-4-yl]methoxy}sulfonic acid details
7,14-dihydroxy-4-(hydroxymethyl)-6-methoxy-12-methyl-5-(3-methylbutanoyl)-10-oxo-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaene-15-carboxylic acid → 7,14-dihydroxy-6-methoxy-12-methyl-5-(3-methylbutanoyl)-10-oxo-4-[(sulfooxy)methyl]-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaene-15-carboxylic acid details
7,14-dihydroxy-4-(hydroxymethyl)-6-methoxy-12-methyl-5-(3-methylbutanoyl)-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaen-10-one → {[7,14-dihydroxy-6-methoxy-12-methyl-5-(3-methylbutanoyl)-10-oxo-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaen-4-yl]methoxy}sulfonic acid details
7,14-dihydroxy-12-(hydroxymethyl)-6-methoxy-4-methyl-5-(3-methylbut-2-enoyl)-10-oxo-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaene-15-carboxylic acid → 7,14-dihydroxy-6-methoxy-4-methyl-5-(3-methylbut-2-enoyl)-10-oxo-12-[(sulfooxy)methyl]-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaene-15-carboxylic acid details
7,14-dihydroxy-12-(hydroxymethyl)-6-methoxy-4-methyl-5-(3-methylbutanoyl)-10-oxo-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaene-15-carbaldehyde → {[15-formyl-7,14-dihydroxy-6-methoxy-4-methyl-5-(3-methylbutanoyl)-10-oxo-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaen-12-yl]methoxy}sulfonic acid details
7,14-dihydroxy-12-(hydroxymethyl)-6-methoxy-4-methyl-5-(3-methylbut-2-enoyl)-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaen-10-one → {[7,14-dihydroxy-6-methoxy-4-methyl-5-(3-methylbut-2-enoyl)-10-oxo-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaen-12-yl]methoxy}sulfonic acid details
7,14-dihydroxy-12-(hydroxymethyl)-6-methoxy-4-methyl-5-(3-methylbutanoyl)-10-oxo-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaene-15-carboxylic acid → 7,14-dihydroxy-6-methoxy-4-methyl-5-(3-methylbutanoyl)-10-oxo-12-[(sulfooxy)methyl]-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaene-15-carboxylic acid details
7,14-dihydroxy-12-(hydroxymethyl)-6-methoxy-4-methyl-5-(3-methylbutanoyl)-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaen-10-one → {[7,14-dihydroxy-6-methoxy-4-methyl-5-(3-methylbutanoyl)-10-oxo-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaen-12-yl]methoxy}sulfonic acid details
Mollicellin D → {[13-chloro-5,14-dihydroxy-7,12-dimethyl-6-(3-methylbut-2-en-1-yl)-10-oxo-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaen-15-yl]methoxy}sulfonic acid details
13-chloro-5,14-dihydroxy-12,15-bis(hydroxymethyl)-7-methyl-6-(3-methylbut-2-en-1-yl)-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaen-10-one → {[13-chloro-5,14-dihydroxy-15-(hydroxymethyl)-7-methyl-6-(3-methylbut-2-en-1-yl)-10-oxo-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaen-12-yl]methoxy}sulfonic acid details
13-chloro-5,14-dihydroxy-12,15-bis(hydroxymethyl)-7-methyl-6-(3-methylbut-2-en-1-yl)-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaen-10-one → {[13-chloro-5,14-dihydroxy-12-(hydroxymethyl)-7-methyl-6-(3-methylbut-2-en-1-yl)-10-oxo-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaen-15-yl]methoxy}sulfonic acid details
13-chloro-5,14-dihydroxy-7,15-bis(hydroxymethyl)-12-methyl-6-(3-methylbut-2-en-1-yl)-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaen-10-one → {[13-chloro-5,14-dihydroxy-15-(hydroxymethyl)-12-methyl-6-(3-methylbut-2-en-1-yl)-10-oxo-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaen-7-yl]methoxy}sulfonic acid details
13-chloro-5,14-dihydroxy-7,15-bis(hydroxymethyl)-12-methyl-6-(3-methylbut-2-en-1-yl)-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaen-10-one → {[13-chloro-5,14-dihydroxy-7-(hydroxymethyl)-12-methyl-6-(3-methylbut-2-en-1-yl)-10-oxo-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaen-15-yl]methoxy}sulfonic acid details
13-chloro-5,14-dihydroxy-6-(4-hydroxy-3-methylbut-2-en-1-yl)-15-(hydroxymethyl)-7,12-dimethyl-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaen-10-one → ({4-[13-chloro-5,14-dihydroxy-15-(hydroxymethyl)-7,12-dimethyl-10-oxo-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaen-6-yl]-2-methylbut-2-en-1-yl}oxy)sulfonic acid details
13-chloro-5,14-dihydroxy-6-(4-hydroxy-3-methylbut-2-en-1-yl)-15-(hydroxymethyl)-7,12-dimethyl-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaen-10-one → {[13-chloro-5,14-dihydroxy-6-(4-hydroxy-3-methylbut-2-en-1-yl)-7,12-dimethyl-10-oxo-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaen-15-yl]methoxy}sulfonic acid details
13-chloro-5,14-dihydroxy-6-[(2E)-4-hydroxy-3-methylbut-2-en-1-yl]-15-(hydroxymethyl)-7,12-dimethyl-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaen-10-one → {[(2E)-4-[13-chloro-5,14-dihydroxy-15-(hydroxymethyl)-7,12-dimethyl-10-oxo-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaen-6-yl]-2-methylbut-2-en-1-yl]oxy}sulfonic acid details
13-chloro-5,14-dihydroxy-6-[(2E)-4-hydroxy-3-methylbut-2-en-1-yl]-15-(hydroxymethyl)-7,12-dimethyl-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaen-10-one → ({13-chloro-5,14-dihydroxy-6-[(2E)-4-hydroxy-3-methylbut-2-en-1-yl]-7,12-dimethyl-10-oxo-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaen-15-yl}methoxy)sulfonic acid details
13-chloro-6-[(3,3-dimethyloxiran-2-yl)methyl]-5,14-dihydroxy-15-(hydroxymethyl)-7,12-dimethyl-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaen-10-one → ({13-chloro-6-[(3,3-dimethyloxiran-2-yl)methyl]-5,14-dihydroxy-7,12-dimethyl-10-oxo-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaen-15-yl}methoxy)sulfonic acid details
13-chloro-5,14-dihydroxy-12-(hydroxymethyl)-7-methyl-6-(3-methylbut-2-en-1-yl)-10-oxo-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(15),3(8),4,6,11,13-hexaene-15-carbaldehyde → {[13-chloro-15-formyl-5,14-dihydroxy-7-methyl-6-(3-methylbut-2-en-1-yl)-10-oxo-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(15),3(8),4,6,11,13-hexaen-12-yl]methoxy}sulfonic acid details
13-chloro-5,14-dihydroxy-7-(hydroxymethyl)-12-methyl-6-(3-methylbut-2-en-1-yl)-10-oxo-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(15),3(8),4,6,11,13-hexaene-15-carbaldehyde → {[13-chloro-15-formyl-5,14-dihydroxy-12-methyl-6-(3-methylbut-2-en-1-yl)-10-oxo-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(15),3(8),4,6,11,13-hexaen-7-yl]methoxy}sulfonic acid details
13-chloro-5,14-dihydroxy-6-(4-hydroxy-3-methylbut-2-en-1-yl)-7,12-dimethyl-10-oxo-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(15),3(8),4,6,11,13-hexaene-15-carbaldehyde → [(4-{13-chloro-15-formyl-5,14-dihydroxy-7,12-dimethyl-10-oxo-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(15),3(8),4,6,11,13-hexaen-6-yl}-2-methylbut-2-en-1-yl)oxy]sulfonic acid details
13-chloro-5,14-dihydroxy-6-[(2E)-4-hydroxy-3-methylbut-2-en-1-yl]-7,12-dimethyl-10-oxo-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(15),3(8),4,6,11,13-hexaene-15-carbaldehyde → {[(2E)-4-{13-chloro-15-formyl-5,14-dihydroxy-7,12-dimethyl-10-oxo-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(15),3(8),4,6,11,13-hexaen-6-yl}-2-methylbut-2-en-1-yl]oxy}sulfonic acid details
13-chloro-5,14-dihydroxy-12-(hydroxymethyl)-7-methyl-6-(3-methylbut-2-en-1-yl)-10-oxo-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaene-15-carboxylic acid → 13-chloro-5,14-dihydroxy-7-methyl-6-(3-methylbut-2-en-1-yl)-10-oxo-12-[(sulfooxy)methyl]-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaene-15-carboxylic acid details
13-chloro-5,14-dihydroxy-12-(hydroxymethyl)-7-methyl-6-(3-methylbut-2-en-1-yl)-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(15),3(8),4,6,11,13-hexaen-10-one → {[13-chloro-5,14-dihydroxy-7-methyl-6-(3-methylbut-2-en-1-yl)-10-oxo-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(15),3(8),4,6,11,13-hexaen-12-yl]methoxy}sulfonic acid details
13-chloro-5,14-dihydroxy-7-(hydroxymethyl)-12-methyl-6-(3-methylbut-2-en-1-yl)-10-oxo-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaene-15-carboxylic acid → 13-chloro-5,14-dihydroxy-12-methyl-6-(3-methylbut-2-en-1-yl)-10-oxo-7-[(sulfooxy)methyl]-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaene-15-carboxylic acid details
13-chloro-5,14-dihydroxy-7-(hydroxymethyl)-12-methyl-6-(3-methylbut-2-en-1-yl)-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(15),3(8),4,6,11,13-hexaen-10-one → {[13-chloro-5,14-dihydroxy-12-methyl-6-(3-methylbut-2-en-1-yl)-10-oxo-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(15),3(8),4,6,11,13-hexaen-7-yl]methoxy}sulfonic acid details
13-chloro-5,14-dihydroxy-6-(4-hydroxy-3-methylbut-2-en-1-yl)-7,12-dimethyl-10-oxo-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaene-15-carboxylic acid → 13-chloro-5,14-dihydroxy-7,12-dimethyl-6-[3-methyl-4-(sulfooxy)but-2-en-1-yl]-10-oxo-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaene-15-carboxylic acid details
13-chloro-5,14-dihydroxy-6-(4-hydroxy-3-methylbut-2-en-1-yl)-7,12-dimethyl-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(15),3(8),4,6,11,13-hexaen-10-one → [(4-{13-chloro-5,14-dihydroxy-7,12-dimethyl-10-oxo-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(15),3(8),4,6,11,13-hexaen-6-yl}-2-methylbut-2-en-1-yl)oxy]sulfonic acid details
13-chloro-5,14-dihydroxy-6-[(2E)-4-hydroxy-3-methylbut-2-en-1-yl]-7,12-dimethyl-10-oxo-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaene-15-carboxylic acid → 13-chloro-5,14-dihydroxy-7,12-dimethyl-6-[(2E)-3-methyl-4-(sulfooxy)but-2-en-1-yl]-10-oxo-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaene-15-carboxylic acid details
13-chloro-5,14-dihydroxy-6-[(2E)-4-hydroxy-3-methylbut-2-en-1-yl]-7,12-dimethyl-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(15),3(8),4,6,11,13-hexaen-10-one → {[(2E)-4-{13-chloro-5,14-dihydroxy-7,12-dimethyl-10-oxo-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(15),3(8),4,6,11,13-hexaen-6-yl}-2-methylbut-2-en-1-yl]oxy}sulfonic acid details
5,14-dihydroxy-15-(hydroxymethyl)-7,12-dimethyl-6-(3-methylbut-2-en-1-yl)-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaen-10-one → {[5,14-dihydroxy-7,12-dimethyl-6-(3-methylbut-2-en-1-yl)-10-oxo-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaen-15-yl]methoxy}sulfonic acid details
5,14-dihydroxy-12-(hydroxymethyl)-7-methyl-6-(3-methylbut-2-en-1-yl)-10-oxo-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaene-15-carbaldehyde → {[15-formyl-5,14-dihydroxy-7-methyl-6-(3-methylbut-2-en-1-yl)-10-oxo-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaen-12-yl]methoxy}sulfonic acid details
5,14-dihydroxy-7-(hydroxymethyl)-12-methyl-6-(3-methylbut-2-en-1-yl)-10-oxo-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaene-15-carbaldehyde → {[15-formyl-5,14-dihydroxy-12-methyl-6-(3-methylbut-2-en-1-yl)-10-oxo-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaen-7-yl]methoxy}sulfonic acid details
5,14-dihydroxy-6-[(2E)-4-hydroxy-3-methylbut-2-en-1-yl]-7,12-dimethyl-10-oxo-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaene-15-carbaldehyde → {[(2E)-4-{15-formyl-5,14-dihydroxy-7,12-dimethyl-10-oxo-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaen-6-yl}-2-methylbut-2-en-1-yl]oxy}sulfonic acid details
5,14-dihydroxy-6-(4-hydroxy-3-methylbut-2-en-1-yl)-7,12-dimethyl-10-oxo-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaene-15-carbaldehyde → [(4-{15-formyl-5,14-dihydroxy-7,12-dimethyl-10-oxo-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaen-6-yl}-2-methylbut-2-en-1-yl)oxy]sulfonic acid details
5,14-dihydroxy-12-(hydroxymethyl)-7-methyl-6-(3-methylbut-2-en-1-yl)-10-oxo-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaene-15-carboxylic acid → 5,14-dihydroxy-7-methyl-6-(3-methylbut-2-en-1-yl)-10-oxo-12-[(sulfooxy)methyl]-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaene-15-carboxylic acid details
5,14-dihydroxy-12-(hydroxymethyl)-7-methyl-6-(3-methylbut-2-en-1-yl)-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaen-10-one → {[5,14-dihydroxy-7-methyl-6-(3-methylbut-2-en-1-yl)-10-oxo-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaen-12-yl]methoxy}sulfonic acid details
5,14-dihydroxy-7-(hydroxymethyl)-12-methyl-6-(3-methylbut-2-en-1-yl)-10-oxo-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaene-15-carboxylic acid → 5,14-dihydroxy-12-methyl-6-(3-methylbut-2-en-1-yl)-10-oxo-7-[(sulfooxy)methyl]-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaene-15-carboxylic acid details
5,14-dihydroxy-7-(hydroxymethyl)-12-methyl-6-(3-methylbut-2-en-1-yl)-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaen-10-one → {[5,14-dihydroxy-12-methyl-6-(3-methylbut-2-en-1-yl)-10-oxo-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaen-7-yl]methoxy}sulfonic acid details
5,14-dihydroxy-6-[(2E)-4-hydroxy-3-methylbut-2-en-1-yl]-7,12-dimethyl-10-oxo-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaene-15-carboxylic acid → 5,14-dihydroxy-7,12-dimethyl-6-[(2E)-3-methyl-4-(sulfooxy)but-2-en-1-yl]-10-oxo-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaene-15-carboxylic acid details
5,14-dihydroxy-6-[(2E)-4-hydroxy-3-methylbut-2-en-1-yl]-7,12-dimethyl-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaen-10-one → {[(2E)-4-{5,14-dihydroxy-7,12-dimethyl-10-oxo-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaen-6-yl}-2-methylbut-2-en-1-yl]oxy}sulfonic acid details
5,14-dihydroxy-6-(4-hydroxy-3-methylbut-2-en-1-yl)-7,12-dimethyl-10-oxo-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaene-15-carboxylic acid → 5,14-dihydroxy-7,12-dimethyl-6-[3-methyl-4-(sulfooxy)but-2-en-1-yl]-10-oxo-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaene-15-carboxylic acid details
5,14-dihydroxy-6-(4-hydroxy-3-methylbut-2-en-1-yl)-7,12-dimethyl-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaen-10-one → [(4-{5,14-dihydroxy-7,12-dimethyl-10-oxo-2,9-dioxatricyclo[9.4.0.0³,⁸]pentadeca-1(11),3(8),4,6,12,14-hexaen-6-yl}-2-methylbut-2-en-1-yl)oxy]sulfonic acid details
3,5,7-trihydroxy-2-(4-methoxyphenyl)-8-(3-methylbut-2-en-1-yl)-3,4-dihydro-2H-1-benzopyran-4-one → [5,7-dihydroxy-2-(4-methoxyphenyl)-8-(3-methylbut-2-en-1-yl)-4-oxo-3,4-dihydro-2H-1-benzopyran-3-yl]oxidanesulfonic acid details
3-(4-hydroxy-3-methoxyphenyl)-2-oxa-6,11-diazatetracyclo[7.5.2.0⁴,¹⁵.0¹²,¹⁶]hexadeca-1(15),5,9,12(16),13-pentaene-5,8-diol → [5-hydroxy-3-(4-hydroxy-3-methoxyphenyl)-2-oxa-6,11-diazatetracyclo[7.5.2.0⁴,¹⁵.0¹²,¹⁶]hexadeca-1(15),5,9,12(16),13-pentaen-8-yl]oxidanesulfonic acid details
N-[2-hydroxy-2-(4-methoxyphenyl)ethyl]-3-phenylpropanimidic acid → N-[2-(4-methoxyphenyl)-2-(sulfooxy)ethyl]-3-phenylpropanimidic acid details
(2E)-N-[2-hydroxy-2-(4-methoxyphenyl)ethyl]-3-(2-hydroxyphenyl)prop-2-enimidic acid → (2E)-3-(2-hydroxyphenyl)-N-[2-(4-methoxyphenyl)-2-(sulfooxy)ethyl]prop-2-enimidic acid details
(2Z)-2-hydroxy-N-[2-hydroxy-2-(4-methoxyphenyl)ethyl]-3-phenylprop-2-enimidic acid → (2Z)-2-hydroxy-N-[2-(4-methoxyphenyl)-2-(sulfooxy)ethyl]-3-phenylprop-2-enimidic acid details
(2E)-N-[2-hydroxy-2-(4-hydroxyphenyl)ethyl]-3-phenylprop-2-enimidic acid → (2E)-N-[2-(4-hydroxyphenyl)-2-(sulfooxy)ethyl]-3-phenylprop-2-enimidic acid details
(2E)-N-[2-hydroxy-2-(4-methoxyphenyl)ethyl]-3-(4-hydroxyphenyl)prop-2-enimidic acid → (2E)-3-(4-hydroxyphenyl)-N-[2-(4-methoxyphenyl)-2-(sulfooxy)ethyl]prop-2-enimidic acid details
(2E)-N-[2-hydroxy-2-(4-methoxyphenyl)ethyl]-3-(3-hydroxyphenyl)prop-2-enimidic acid → (2E)-3-(3-hydroxyphenyl)-N-[2-(4-methoxyphenyl)-2-(sulfooxy)ethyl]prop-2-enimidic acid details
N-[2-hydroxy-2-(4-methoxyphenyl)ethyl]-3-phenyloxirane-2-carboximidic acid → N-[2-(4-methoxyphenyl)-2-(sulfooxy)ethyl]-3-phenyloxirane-2-carboximidic acid details
(2E)-N-[2-hydroxy-2-(1-hydroxy-4-oxocyclohexa-2,5-dien-1-yl)ethyl]-3-phenylprop-2-enimidic acid → (2E)-N-[2-(1-hydroxy-4-oxocyclohexa-2,5-dien-1-yl)-2-(sulfooxy)ethyl]-3-phenylprop-2-enimidic acid details
N-[2-hydroxy-2-(4-methoxyphenyl)ethyl]-3-(2-hydroxyphenyl)propanimidic acid → 3-(2-hydroxyphenyl)-N-[2-(4-methoxyphenyl)-2-(sulfooxy)ethyl]propanimidic acid details
3-hydroxy-N-[2-hydroxy-2-(4-methoxyphenyl)ethyl]-3-phenylpropanimidic acid → N-[2-hydroxy-2-(4-methoxyphenyl)ethyl]-3-phenyl-3-(sulfooxy)propanimidic acid details
3-hydroxy-N-[2-hydroxy-2-(4-methoxyphenyl)ethyl]-3-phenylpropanimidic acid → 3-hydroxy-N-[2-(4-methoxyphenyl)-2-(sulfooxy)ethyl]-3-phenylpropanimidic acid details
N-[2-hydroxy-2-(4-hydroxyphenyl)ethyl]-3-phenylpropanimidic acid → N-[2-(4-hydroxyphenyl)-2-(sulfooxy)ethyl]-3-phenylpropanimidic acid details
N-[2-hydroxy-2-(4-methoxyphenyl)ethyl]-3-(3-hydroxyphenyl)propanimidic acid → 3-(3-hydroxyphenyl)-N-[2-(4-methoxyphenyl)-2-(sulfooxy)ethyl]propanimidic acid details
N-[2-hydroxy-2-(4-methoxyphenyl)ethyl]-3-(4-hydroxyphenyl)propanimidic acid → 3-(4-hydroxyphenyl)-N-[2-(4-methoxyphenyl)-2-(sulfooxy)ethyl]propanimidic acid details
2-hydroxy-N-[2-hydroxy-2-(4-methoxyphenyl)ethyl]-3-phenylpropanimidic acid → N-[2-hydroxy-2-(4-methoxyphenyl)ethyl]-3-phenyl-2-(sulfooxy)propanimidic acid details
2-hydroxy-N-[2-hydroxy-2-(4-methoxyphenyl)ethyl]-3-phenylpropanimidic acid → 2-hydroxy-N-[2-(4-methoxyphenyl)-2-(sulfooxy)ethyl]-3-phenylpropanimidic acid details
N-[2-hydroxy-2-(1-hydroxy-4-oxocyclohexa-2,5-dien-1-yl)ethyl]-3-phenylpropanimidic acid → N-[2-(1-hydroxy-4-oxocyclohexa-2,5-dien-1-yl)-2-(sulfooxy)ethyl]-3-phenylpropanimidic acid details
4-Coumaroyl-2-hydroxyputrescine → (2E)-N-[4-amino-2-(sulfooxy)butyl]-3-(4-hydroxyphenyl)prop-2-enimidic acid details
(2E)-N-(4-amino-3-hydroxybutyl)-3-(4-hydroxyphenyl)prop-2-enimidic acid → (2E)-N-[4-amino-3-(sulfooxy)butyl]-3-(4-hydroxyphenyl)prop-2-enimidic acid details
N-(4-amino-2-hydroxybutyl)-3-(4-hydroxyphenyl)propanimidic acid → N-[4-amino-2-(sulfooxy)butyl]-3-(4-hydroxyphenyl)propanimidic acid details
N-(4-amino-3-hydroxybutyl)-3-(4-hydroxyphenyl)propanimidic acid → N-[4-amino-3-(sulfooxy)butyl]-3-(4-hydroxyphenyl)propanimidic acid details
N-(4-aminobutyl)-3-hydroxy-3-(4-hydroxyphenyl)propanimidic acid → N-(4-aminobutyl)-3-(4-hydroxyphenyl)-3-(sulfooxy)propanimidic acid details
N-(4-aminobutyl)-2-hydroxy-3-(4-hydroxyphenyl)propanimidic acid → N-(4-aminobutyl)-3-(4-hydroxyphenyl)-2-(sulfooxy)propanimidic acid details
(2E)-N-(4-amino-2-hydroxybutyl)-3-(3,4-dihydroxyphenyl)prop-2-enimidic acid → (2E)-N-[4-amino-2-(sulfooxy)butyl]-3-(3,4-dihydroxyphenyl)prop-2-enimidic acid details
(2E)-N-(4-amino-2,3-dihydroxybutyl)-3-(4-hydroxyphenyl)prop-2-enimidic acid → (2E)-N-[4-amino-2-hydroxy-3-(sulfooxy)butyl]-3-(4-hydroxyphenyl)prop-2-enimidic acid details
(2E)-N-(4-amino-2,3-dihydroxybutyl)-3-(4-hydroxyphenyl)prop-2-enimidic acid → (2E)-N-[4-amino-3-hydroxy-2-(sulfooxy)butyl]-3-(4-hydroxyphenyl)prop-2-enimidic acid details
(2E)-N-(4-amino-2-hydroxybutyl)-3-(2,4-dihydroxyphenyl)prop-2-enimidic acid → (2E)-N-[4-amino-2-(sulfooxy)butyl]-3-(2,4-dihydroxyphenyl)prop-2-enimidic acid details
N-(4-amino-2-hydroxybutyl)-3-(4-hydroxyphenyl)oxirane-2-carboximidic acid → N-[4-amino-2-(sulfooxy)butyl]-3-(4-hydroxyphenyl)oxirane-2-carboximidic acid details
N-(4-amino-2-hydroxybutyl)-3-hydroxy-3-(4-hydroxyphenyl)propanimidic acid → N-(4-amino-2-hydroxybutyl)-3-(4-hydroxyphenyl)-3-(sulfooxy)propanimidic acid details
N-(4-amino-2-hydroxybutyl)-3-hydroxy-3-(4-hydroxyphenyl)propanimidic acid → N-[4-amino-2-(sulfooxy)butyl]-3-hydroxy-3-(4-hydroxyphenyl)propanimidic acid details
N-(4-amino-2-hydroxybutyl)-3-(3,4-dihydroxyphenyl)propanimidic acid → N-[4-amino-2-(sulfooxy)butyl]-3-(3,4-dihydroxyphenyl)propanimidic acid details
N-(4-amino-2-hydroxybutyl)-2-hydroxy-3-(4-hydroxyphenyl)propanimidic acid → N-(4-amino-2-hydroxybutyl)-3-(4-hydroxyphenyl)-2-(sulfooxy)propanimidic acid details
N-(4-amino-2-hydroxybutyl)-2-hydroxy-3-(4-hydroxyphenyl)propanimidic acid → N-[4-amino-2-(sulfooxy)butyl]-2-hydroxy-3-(4-hydroxyphenyl)propanimidic acid details
N-(4-amino-3-hydroxybutyl)-3-(4-hydroxy-3-methoxyphenyl)prop-2-enimidic acid → N-[4-amino-3-(sulfooxy)butyl]-3-(4-hydroxy-3-methoxyphenyl)prop-2-enimidic acid details
N-(4-amino-2-hydroxybutyl)-3-(4-hydroxy-3-methoxyphenyl)prop-2-enimidic acid → N-[4-amino-2-(sulfooxy)butyl]-3-(4-hydroxy-3-methoxyphenyl)prop-2-enimidic acid details
N-(4-amino-3-hydroxybutyl)-3-(4-hydroxy-3-methoxyphenyl)propanimidic acid → N-[4-amino-3-(sulfooxy)butyl]-3-(4-hydroxy-3-methoxyphenyl)propanimidic acid details
N-(4-amino-2-hydroxybutyl)-3-(4-hydroxy-3-methoxyphenyl)propanimidic acid → N-[4-amino-2-(sulfooxy)butyl]-3-(4-hydroxy-3-methoxyphenyl)propanimidic acid details
N-(4-aminobutyl)-3-hydroxy-3-(4-hydroxy-3-methoxyphenyl)propanimidic acid → N-(4-aminobutyl)-3-(4-hydroxy-3-methoxyphenyl)-3-(sulfooxy)propanimidic acid details
N-(4-aminobutyl)-2-hydroxy-3-(4-hydroxy-3-methoxyphenyl)propanimidic acid → N-(4-aminobutyl)-3-(4-hydroxy-3-methoxyphenyl)-2-(sulfooxy)propanimidic acid details
N-(4-amino-3-hydroxybutyl)-3-(4-hydroxy-3,5-dimethoxyphenyl)prop-2-enimidic acid → N-[4-amino-3-(sulfooxy)butyl]-3-(4-hydroxy-3,5-dimethoxyphenyl)prop-2-enimidic acid details
N-(4-amino-2-hydroxybutyl)-3-(4-hydroxy-3,5-dimethoxyphenyl)prop-2-enimidic acid → N-[4-amino-2-(sulfooxy)butyl]-3-(4-hydroxy-3,5-dimethoxyphenyl)prop-2-enimidic acid details
N-(4-amino-3-hydroxybutyl)-3-(4-hydroxy-3,5-dimethoxyphenyl)propanimidic acid → N-[4-amino-3-(sulfooxy)butyl]-3-(4-hydroxy-3,5-dimethoxyphenyl)propanimidic acid details
N-(4-amino-2-hydroxybutyl)-3-(4-hydroxy-3,5-dimethoxyphenyl)propanimidic acid → N-[4-amino-2-(sulfooxy)butyl]-3-(4-hydroxy-3,5-dimethoxyphenyl)propanimidic acid details
N-(4-aminobutyl)-3-hydroxy-3-(4-hydroxy-3,5-dimethoxyphenyl)propanimidic acid → N-(4-aminobutyl)-3-(4-hydroxy-3,5-dimethoxyphenyl)-3-(sulfooxy)propanimidic acid details
N-(4-aminobutyl)-2-hydroxy-3-(4-hydroxy-3,5-dimethoxyphenyl)propanimidic acid → N-(4-aminobutyl)-3-(4-hydroxy-3,5-dimethoxyphenyl)-2-(sulfooxy)propanimidic acid details
N-(4-amino-2,3-dihydroxybutyl)-3-(4-hydroxy-3-methoxyphenyl)prop-2-enimidic acid → N-[4-amino-2-hydroxy-3-(sulfooxy)butyl]-3-(4-hydroxy-3-methoxyphenyl)prop-2-enimidic acid details
N-(4-amino-2,3-dihydroxybutyl)-3-(4-hydroxy-3-methoxyphenyl)prop-2-enimidic acid → N-[4-amino-3-hydroxy-2-(sulfooxy)butyl]-3-(4-hydroxy-3-methoxyphenyl)prop-2-enimidic acid details
N-(4-amino-2-hydroxybutyl)-3-(4-hydroxy-3-methoxyphenyl)oxirane-2-carboximidic acid → N-[4-amino-2-(sulfooxy)butyl]-3-(4-hydroxy-3-methoxyphenyl)oxirane-2-carboximidic acid details
N-(4-amino-2-hydroxybutyl)-3-(3,4-dihydroxyphenyl)prop-2-enimidic acid → N-[4-amino-2-(sulfooxy)butyl]-3-(3,4-dihydroxyphenyl)prop-2-enimidic acid details
N-(4-amino-2-hydroxybutyl)-3-(3,4-dihydroxy-5-methoxyphenyl)prop-2-enimidic acid → N-[4-amino-2-(sulfooxy)butyl]-3-(3,4-dihydroxy-5-methoxyphenyl)prop-2-enimidic acid details
N-(4-amino-2-hydroxybutyl)-3-(2,4-dihydroxy-5-methoxyphenyl)prop-2-enimidic acid → N-[4-amino-2-(sulfooxy)butyl]-3-(2,4-dihydroxy-5-methoxyphenyl)prop-2-enimidic acid details
N-(4-amino-2-hydroxybutyl)-3-(2,4-dihydroxy-3-methoxyphenyl)prop-2-enimidic acid → N-[4-amino-2-(sulfooxy)butyl]-3-(2,4-dihydroxy-3-methoxyphenyl)prop-2-enimidic acid details
N-(4-amino-2-hydroxybutyl)-3-(3,4-dihydroxy-5-methoxyphenyl)propanimidic acid → N-[4-amino-2-(sulfooxy)butyl]-3-(3,4-dihydroxy-5-methoxyphenyl)propanimidic acid details
N-(4-amino-2-hydroxybutyl)-3-hydroxy-3-(4-hydroxy-3-methoxyphenyl)propanimidic acid → N-(4-amino-2-hydroxybutyl)-3-(4-hydroxy-3-methoxyphenyl)-3-(sulfooxy)propanimidic acid details
N-(4-amino-2-hydroxybutyl)-3-hydroxy-3-(4-hydroxy-3-methoxyphenyl)propanimidic acid → N-[4-amino-2-(sulfooxy)butyl]-3-hydroxy-3-(4-hydroxy-3-methoxyphenyl)propanimidic acid details
N-(4-amino-2-hydroxybutyl)-2-hydroxy-3-(4-hydroxy-3-methoxyphenyl)propanimidic acid → N-(4-amino-2-hydroxybutyl)-3-(4-hydroxy-3-methoxyphenyl)-2-(sulfooxy)propanimidic acid details
N-(4-amino-2-hydroxybutyl)-2-hydroxy-3-(4-hydroxy-3-methoxyphenyl)propanimidic acid → N-[4-amino-2-(sulfooxy)butyl]-2-hydroxy-3-(4-hydroxy-3-methoxyphenyl)propanimidic acid details
N-{4-[(3-amino-2-hydroxypropyl)amino]butyl}-N-(3-aminopropyl)-3-(4-hydroxy-3,5-dimethoxyphenyl)prop-2-enamide → {[1-amino-3-({4-[N-(3-aminopropyl)-3-(4-hydroxy-3,5-dimethoxyphenyl)prop-2-enamido]butyl}amino)propan-2-yl]oxy}sulfonic acid details
N-(3-aminopropyl)-N-{4-[(3-aminopropyl)amino]-3-hydroxybutyl}-3-(4-hydroxy-3,5-dimethoxyphenyl)prop-2-enamide → ({4-[N-(3-aminopropyl)-3-(4-hydroxy-3,5-dimethoxyphenyl)prop-2-enamido]-1-[(3-aminopropyl)amino]butan-2-yl}oxy)sulfonic acid details
N-(3-aminopropyl)-N-{4-[(3-aminopropyl)amino]-2-hydroxybutyl}-3-(4-hydroxy-3,5-dimethoxyphenyl)prop-2-enamide → ({1-[N-(3-aminopropyl)-3-(4-hydroxy-3,5-dimethoxyphenyl)prop-2-enamido]-4-[(3-aminopropyl)amino]butan-2-yl}oxy)sulfonic acid details
N-(3-amino-2-hydroxypropyl)-N-{4-[(3-aminopropyl)amino]butyl}-3-(4-hydroxy-3,5-dimethoxyphenyl)prop-2-enamide → {[1-amino-3-(N-{4-[(3-aminopropyl)amino]butyl}-3-(4-hydroxy-3,5-dimethoxyphenyl)prop-2-enamido)propan-2-yl]oxy}sulfonic acid details
N-{4-[(3-amino-2-hydroxypropyl)amino]butyl}-N-(3-aminopropyl)-3-(4-hydroxy-3,5-dimethoxyphenyl)propanamide → {[1-amino-3-({4-[N-(3-aminopropyl)-3-(4-hydroxy-3,5-dimethoxyphenyl)propanamido]butyl}amino)propan-2-yl]oxy}sulfonic acid details
N-(3-aminopropyl)-N-{4-[(3-aminopropyl)amino]-3-hydroxybutyl}-3-(4-hydroxy-3,5-dimethoxyphenyl)propanamide → ({4-[N-(3-aminopropyl)-3-(4-hydroxy-3,5-dimethoxyphenyl)propanamido]-1-[(3-aminopropyl)amino]butan-2-yl}oxy)sulfonic acid details
N-(3-aminopropyl)-N-{4-[(3-aminopropyl)amino]-2-hydroxybutyl}-3-(4-hydroxy-3,5-dimethoxyphenyl)propanamide → ({1-[N-(3-aminopropyl)-3-(4-hydroxy-3,5-dimethoxyphenyl)propanamido]-4-[(3-aminopropyl)amino]butan-2-yl}oxy)sulfonic acid details
N-(3-amino-2-hydroxypropyl)-N-{4-[(3-aminopropyl)amino]butyl}-3-(4-hydroxy-3,5-dimethoxyphenyl)propanamide → {[1-amino-3-(N-{4-[(3-aminopropyl)amino]butyl}-3-(4-hydroxy-3,5-dimethoxyphenyl)propanamido)propan-2-yl]oxy}sulfonic acid details
N-(3-aminopropyl)-N-{4-[(3-aminopropyl)amino]butyl}-3-hydroxy-3-(4-hydroxy-3,5-dimethoxyphenyl)propanamide → {2-[(3-aminopropyl)({4-[(3-aminopropyl)amino]butyl})carbamoyl]-1-(4-hydroxy-3,5-dimethoxyphenyl)ethoxy}sulfonic acid details
N-(3-aminopropyl)-N-{4-[(3-aminopropyl)amino]butyl}-2-hydroxy-3-(4-hydroxy-3,5-dimethoxyphenyl)propanamide → {1-[(3-aminopropyl)({4-[(3-aminopropyl)amino]butyl})carbamoyl]-2-(4-hydroxy-3,5-dimethoxyphenyl)ethoxy}sulfonic acid details
3-aminopropan-1-ol → (3-aminopropoxy)sulfonic acid details
5-hydroxy-6-[(2E)-4-hydroxy-3-methylbut-2-en-1-yl]-8,8-dimethyl-2H,8H-pyrano[2,3-h]chromen-2-one → {[(2E)-4-{5-hydroxy-8,8-dimethyl-2-oxo-2H,8H-pyrano[2,3-h]chromen-6-yl}-2-methylbut-2-en-1-yl]oxy}sulfonic acid details
5-hydroxy-6-(4-hydroxy-3-methylbut-2-en-1-yl)-8,8-dimethyl-2H,8H-pyrano[2,3-h]chromen-2-one → [(4-{5-hydroxy-8,8-dimethyl-2-oxo-2H,8H-pyrano[2,3-h]chromen-6-yl}-2-methylbut-2-en-1-yl)oxy]sulfonic acid details
5-hydroxy-8-(hydroxymethyl)-8-methyl-6-(3-methylbut-2-en-1-yl)-2H,8H-pyrano[2,3-h]chromen-2-one → {[5-hydroxy-8-methyl-6-(3-methylbut-2-en-1-yl)-2-oxo-2H,8H-pyrano[2,3-h]chromen-8-yl]methoxy}sulfonic acid details
5,7-dihydroxy-2-[4-hydroxy-3-(4-hydroxy-3-methylbut-2-en-1-yl)-5-(3-methylbut-2-en-1-yl)phenyl]-4H-chromen-4-one → ({4-[5-(5,7-dihydroxy-4-oxo-4H-chromen-2-yl)-2-hydroxy-3-(3-methylbut-2-en-1-yl)phenyl]-2-methylbut-2-en-1-yl}oxy)sulfonic acid details
5,7-dihydroxy-2-{4-hydroxy-3-[(2E)-4-hydroxy-3-methylbut-2-en-1-yl]-5-(3-methylbut-2-en-1-yl)phenyl}-4H-chromen-4-one → {[(2E)-4-[5-(5,7-dihydroxy-4-oxo-4H-chromen-2-yl)-2-hydroxy-3-(3-methylbut-2-en-1-yl)phenyl]-2-methylbut-2-en-1-yl]oxy}sulfonic acid details
Fragransol A → ({1-[2-(4-hydroxy-3-methoxyphenyl)-7-methoxy-3-methyl-2,3-dihydro-1-benzofuran-5-yl]-1-methoxypropan-2-yl}oxy)sulfonic acid details
4-[5-(2-hydroxy-1-methoxypropyl)-3-(hydroxymethyl)-7-methoxy-2,3-dihydro-1-benzofuran-2-yl]-2-methoxyphenol → {[5-(2-hydroxy-1-methoxypropyl)-2-(4-hydroxy-3-methoxyphenyl)-7-methoxy-2,3-dihydro-1-benzofuran-3-yl]methoxy}sulfonic acid details
4-[5-(2-hydroxy-1-methoxypropyl)-3-(hydroxymethyl)-7-methoxy-2,3-dihydro-1-benzofuran-2-yl]-2-methoxyphenol → ({1-[2-(4-hydroxy-3-methoxyphenyl)-3-(hydroxymethyl)-7-methoxy-2,3-dihydro-1-benzofuran-5-yl]-1-methoxypropan-2-yl}oxy)sulfonic acid details
5-(2-hydroxy-1-methoxypropyl)-2-(4-hydroxy-3-methoxyphenyl)-7-methoxy-3-methyl-2,3-dihydro-1-benzofuran-3-ol → ({1-[3-hydroxy-2-(4-hydroxy-3-methoxyphenyl)-7-methoxy-3-methyl-2,3-dihydro-1-benzofuran-5-yl]-1-methoxypropan-2-yl}oxy)sulfonic acid details
5-(2-hydroxy-1-methoxypropyl)-2-(4-hydroxy-3-methoxyphenyl)-7-methoxy-3-methyl-2,3-dihydro-1-benzofuran-6-ol → ({1-[6-hydroxy-2-(4-hydroxy-3-methoxyphenyl)-7-methoxy-3-methyl-2,3-dihydro-1-benzofuran-5-yl]-1-methoxypropan-2-yl}oxy)sulfonic acid details
3-[2-(4-hydroxy-3-methoxyphenyl)-7-methoxy-3-methyl-2,3-dihydro-1-benzofuran-5-yl]-3-methoxypropane-1,2-diol → {2-hydroxy-3-[2-(4-hydroxy-3-methoxyphenyl)-7-methoxy-3-methyl-2,3-dihydro-1-benzofuran-5-yl]-3-methoxypropoxy}sulfonic acid details
3-[2-(4-hydroxy-3-methoxyphenyl)-7-methoxy-3-methyl-2,3-dihydro-1-benzofuran-5-yl]-3-methoxypropane-1,2-diol → ({3-hydroxy-1-[2-(4-hydroxy-3-methoxyphenyl)-7-methoxy-3-methyl-2,3-dihydro-1-benzofuran-5-yl]-1-methoxypropan-2-yl}oxy)sulfonic acid details
4-[5-(2-hydroxy-1-methoxypropyl)-7-methoxy-3-methyl-2,3-dihydro-1-benzofuran-2-yl]benzene-1,2-diol → ({1-[2-(3,4-dihydroxyphenyl)-7-methoxy-3-methyl-2,3-dihydro-1-benzofuran-5-yl]-1-methoxypropan-2-yl}oxy)sulfonic acid details
5-[5-(2-hydroxy-1-methoxypropyl)-7-methoxy-3-methyl-2,3-dihydro-1-benzofuran-2-yl]-3-methoxybenzene-1,2-diol → ({1-[2-(3,4-dihydroxy-5-methoxyphenyl)-7-methoxy-3-methyl-2,3-dihydro-1-benzofuran-5-yl]-1-methoxypropan-2-yl}oxy)sulfonic acid details
5-(2-hydroxy-1-methoxypropyl)-2-(4-hydroxy-3-methoxyphenyl)-3-methyl-2,3-dihydro-1-benzofuran-7-ol → ({1-[7-hydroxy-2-(4-hydroxy-3-methoxyphenyl)-3-methyl-2,3-dihydro-1-benzofuran-5-yl]-1-methoxypropan-2-yl}oxy)sulfonic acid details
5-(2-hydroxy-1-methoxypropyl)-7-methoxy-2-(3-methoxyphenyl)-3-methyl-2,3-dihydro-1-benzofuran-6-ol → ({1-[6-hydroxy-7-methoxy-2-(3-methoxyphenyl)-3-methyl-2,3-dihydro-1-benzofuran-5-yl]-1-methoxypropan-2-yl}oxy)sulfonic acid details
5-(2-hydroxy-1-methoxypropyl)-2-(3-methoxyphenyl)-3-methyl-2,3-dihydro-1-benzofuran-7-ol → ({1-[7-hydroxy-2-(3-methoxyphenyl)-3-methyl-2,3-dihydro-1-benzofuran-5-yl]-1-methoxypropan-2-yl}oxy)sulfonic acid details
Fragransol B → {2-[2-(4-hydroxy-3-methoxyphenyl)-7-methoxy-3-methyl-2,3-dihydro-1-benzofuran-5-yl]ethoxy}sulfonic acid details
4-[5-(2-hydroxyethyl)-3-(hydroxymethyl)-7-methoxy-2,3-dihydro-1-benzofuran-2-yl]-2-methoxyphenol → {[2-(4-hydroxy-3-methoxyphenyl)-5-(2-hydroxyethyl)-7-methoxy-2,3-dihydro-1-benzofuran-3-yl]methoxy}sulfonic acid details
4-[5-(2-hydroxyethyl)-3-(hydroxymethyl)-7-methoxy-2,3-dihydro-1-benzofuran-2-yl]-2-methoxyphenol → {2-[2-(4-hydroxy-3-methoxyphenyl)-3-(hydroxymethyl)-7-methoxy-2,3-dihydro-1-benzofuran-5-yl]ethoxy}sulfonic acid details
2-(4-hydroxy-3-methoxyphenyl)-5-(2-hydroxyethyl)-7-methoxy-3-methyl-2,3-dihydro-1-benzofuran-3-ol → {2-[3-hydroxy-2-(4-hydroxy-3-methoxyphenyl)-7-methoxy-3-methyl-2,3-dihydro-1-benzofuran-5-yl]ethoxy}sulfonic acid details
2-(4-hydroxy-3-methoxyphenyl)-5-(2-hydroxyethyl)-7-methoxy-3-methyl-2,3-dihydro-1-benzofuran-6-ol → {2-[6-hydroxy-2-(4-hydroxy-3-methoxyphenyl)-7-methoxy-3-methyl-2,3-dihydro-1-benzofuran-5-yl]ethoxy}sulfonic acid details
4-[5-(2-hydroxyethyl)-7-methoxy-3-methyl-2,3-dihydro-1-benzofuran-2-yl]benzene-1,2-diol → {2-[2-(3,4-dihydroxyphenyl)-7-methoxy-3-methyl-2,3-dihydro-1-benzofuran-5-yl]ethoxy}sulfonic acid details
2-(4-hydroxy-3-methoxyphenyl)-5-(2-hydroxyethyl)-3-methyl-2,3-dihydro-1-benzofuran-7-ol → {2-[7-hydroxy-2-(4-hydroxy-3-methoxyphenyl)-3-methyl-2,3-dihydro-1-benzofuran-5-yl]ethoxy}sulfonic acid details
5-[5-(2-hydroxyethyl)-7-methoxy-3-methyl-2,3-dihydro-1-benzofuran-2-yl]-3-methoxybenzene-1,2-diol → {2-[2-(3,4-dihydroxy-5-methoxyphenyl)-7-methoxy-3-methyl-2,3-dihydro-1-benzofuran-5-yl]ethoxy}sulfonic acid details
1-[2-(4-hydroxy-3-methoxyphenyl)-7-methoxy-3-methyl-2,3-dihydro-1-benzofuran-5-yl]ethane-1,2-diol → {2-hydroxy-2-[2-(4-hydroxy-3-methoxyphenyl)-7-methoxy-3-methyl-2,3-dihydro-1-benzofuran-5-yl]ethoxy}sulfonic acid details
1-[2-(4-hydroxy-3-methoxyphenyl)-7-methoxy-3-methyl-2,3-dihydro-1-benzofuran-5-yl]ethane-1,2-diol → {2-hydroxy-1-[2-(4-hydroxy-3-methoxyphenyl)-7-methoxy-3-methyl-2,3-dihydro-1-benzofuran-5-yl]ethoxy}sulfonic acid details
5-(2-hydroxyethyl)-7-methoxy-2-(3-methoxyphenyl)-3-methyl-2,3-dihydro-1-benzofuran-6-ol → {2-[6-hydroxy-7-methoxy-2-(3-methoxyphenyl)-3-methyl-2,3-dihydro-1-benzofuran-5-yl]ethoxy}sulfonic acid details
5-(2-hydroxyethyl)-2-(3-methoxyphenyl)-3-methyl-2,3-dihydro-1-benzofuran-7-ol → {2-[7-hydroxy-2-(3-methoxyphenyl)-3-methyl-2,3-dihydro-1-benzofuran-5-yl]ethoxy}sulfonic acid details
6-beta-D-Glucopyranosyl-8-beta-D-ribopyranosylapigenin → ({6-[5,7-dihydroxy-2-(4-hydroxyphenyl)-4-oxo-8-(3,4,5-trihydroxyoxan-2-yl)-4H-chromen-6-yl]-3,4,5-trihydroxyoxan-2-yl}methoxy)sulfonic acid details
6-beta-D-Glucopyranosyl-8-beta-D-ribopyranosylapigenin → {2-[5,7-dihydroxy-2-(4-hydroxyphenyl)-4-oxo-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-8-yl]-4,5-dihydroxyoxan-3-yl}oxidanesulfonic acid details
6-beta-D-Glucopyranosyl-8-beta-D-ribopyranosylapigenin → {2-[5,7-dihydroxy-2-(4-hydroxyphenyl)-4-oxo-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-8-yl]-3,5-dihydroxyoxan-4-yl}oxidanesulfonic acid details
6-beta-D-Glucopyranosyl-8-beta-D-ribopyranosylapigenin → {6-[5,7-dihydroxy-2-(4-hydroxyphenyl)-4-oxo-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-8-yl]-4,5-dihydroxyoxan-3-yl}oxidanesulfonic acid details
6-beta-D-Glucopyranosyl-8-beta-D-ribopyranosylapigenin → {6-[5,7-dihydroxy-2-(4-hydroxyphenyl)-4-oxo-8-(3,4,5-trihydroxyoxan-2-yl)-4H-chromen-6-yl]-4,5-dihydroxy-2-(hydroxymethyl)oxan-3-yl}oxidanesulfonic acid details
6-beta-D-Glucopyranosyl-8-beta-D-ribopyranosylapigenin → {2-[5,7-dihydroxy-2-(4-hydroxyphenyl)-4-oxo-8-(3,4,5-trihydroxyoxan-2-yl)-4H-chromen-6-yl]-3,5-dihydroxy-6-(hydroxymethyl)oxan-4-yl}oxidanesulfonic acid details
6-beta-D-Glucopyranosyl-8-beta-D-ribopyranosylapigenin → {2-[5,7-dihydroxy-2-(4-hydroxyphenyl)-4-oxo-8-(3,4,5-trihydroxyoxan-2-yl)-4H-chromen-6-yl]-4,5-dihydroxy-6-(hydroxymethyl)oxan-3-yl}oxidanesulfonic acid details
Neocarlinoside → ({6-[2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-4-oxo-8-(3,4,5-trihydroxyoxan-2-yl)-4H-chromen-6-yl]-3,4,5-trihydroxyoxan-2-yl}methoxy)sulfonic acid details
Neocarlinoside → {2-[2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-4-oxo-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-8-yl]-4,5-dihydroxyoxan-3-yl}oxidanesulfonic acid details
Neocarlinoside → {2-[2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-4-oxo-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-8-yl]-3,5-dihydroxyoxan-4-yl}oxidanesulfonic acid details
Neocarlinoside → {6-[2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-4-oxo-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-8-yl]-4,5-dihydroxyoxan-3-yl}oxidanesulfonic acid details
Neocarlinoside → {6-[2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-4-oxo-8-(3,4,5-trihydroxyoxan-2-yl)-4H-chromen-6-yl]-4,5-dihydroxy-2-(hydroxymethyl)oxan-3-yl}oxidanesulfonic acid details
Neocarlinoside → {2-[2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-4-oxo-8-(3,4,5-trihydroxyoxan-2-yl)-4H-chromen-6-yl]-3,5-dihydroxy-6-(hydroxymethyl)oxan-4-yl}oxidanesulfonic acid details
Neocarlinoside → {2-[2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-4-oxo-8-(3,4,5-trihydroxyoxan-2-yl)-4H-chromen-6-yl]-4,5-dihydroxy-6-(hydroxymethyl)oxan-3-yl}oxidanesulfonic acid details
5,7-dihydroxy-2-phenyl-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-8-(3,4,5-trihydroxyoxan-2-yl)-4H-chromen-4-one → ({6-[5,7-dihydroxy-4-oxo-2-phenyl-8-(3,4,5-trihydroxyoxan-2-yl)-4H-chromen-6-yl]-3,4,5-trihydroxyoxan-2-yl}methoxy)sulfonic acid details
5,7-dihydroxy-2-phenyl-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-8-(3,4,5-trihydroxyoxan-2-yl)-4H-chromen-4-one → (2-{5,7-dihydroxy-4-oxo-2-phenyl-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-8-yl}-4,5-dihydroxyoxan-3-yl)oxidanesulfonic acid details
5,7-dihydroxy-2-phenyl-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-8-(3,4,5-trihydroxyoxan-2-yl)-4H-chromen-4-one → (2-{5,7-dihydroxy-4-oxo-2-phenyl-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-8-yl}-3,5-dihydroxyoxan-4-yl)oxidanesulfonic acid details
5,7-dihydroxy-2-phenyl-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-8-(3,4,5-trihydroxyoxan-2-yl)-4H-chromen-4-one → (6-{5,7-dihydroxy-4-oxo-2-phenyl-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-8-yl}-4,5-dihydroxyoxan-3-yl)oxidanesulfonic acid details
5,7-dihydroxy-2-phenyl-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-8-(3,4,5-trihydroxyoxan-2-yl)-4H-chromen-4-one → {6-[5,7-dihydroxy-4-oxo-2-phenyl-8-(3,4,5-trihydroxyoxan-2-yl)-4H-chromen-6-yl]-4,5-dihydroxy-2-(hydroxymethyl)oxan-3-yl}oxidanesulfonic acid details
5,7-dihydroxy-2-phenyl-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-8-(3,4,5-trihydroxyoxan-2-yl)-4H-chromen-4-one → {2-[5,7-dihydroxy-4-oxo-2-phenyl-8-(3,4,5-trihydroxyoxan-2-yl)-4H-chromen-6-yl]-3,5-dihydroxy-6-(hydroxymethyl)oxan-4-yl}oxidanesulfonic acid details
5,7-dihydroxy-2-phenyl-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-8-(3,4,5-trihydroxyoxan-2-yl)-4H-chromen-4-one → {2-[5,7-dihydroxy-4-oxo-2-phenyl-8-(3,4,5-trihydroxyoxan-2-yl)-4H-chromen-6-yl]-4,5-dihydroxy-6-(hydroxymethyl)oxan-3-yl}oxidanesulfonic acid details
5,7-dihydroxy-2-(3-hydroxyphenyl)-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-8-(3,4,5-trihydroxyoxan-2-yl)-4H-chromen-4-one → ({6-[5,7-dihydroxy-2-(3-hydroxyphenyl)-4-oxo-8-(3,4,5-trihydroxyoxan-2-yl)-4H-chromen-6-yl]-3,4,5-trihydroxyoxan-2-yl}methoxy)sulfonic acid details
5,7-dihydroxy-2-(3-hydroxyphenyl)-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-8-(3,4,5-trihydroxyoxan-2-yl)-4H-chromen-4-one → {2-[5,7-dihydroxy-2-(3-hydroxyphenyl)-4-oxo-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-8-yl]-4,5-dihydroxyoxan-3-yl}oxidanesulfonic acid details
5,7-dihydroxy-2-(3-hydroxyphenyl)-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-8-(3,4,5-trihydroxyoxan-2-yl)-4H-chromen-4-one → {2-[5,7-dihydroxy-2-(3-hydroxyphenyl)-4-oxo-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-8-yl]-3,5-dihydroxyoxan-4-yl}oxidanesulfonic acid details
5,7-dihydroxy-2-(3-hydroxyphenyl)-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-8-(3,4,5-trihydroxyoxan-2-yl)-4H-chromen-4-one → {6-[5,7-dihydroxy-2-(3-hydroxyphenyl)-4-oxo-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-8-yl]-4,5-dihydroxyoxan-3-yl}oxidanesulfonic acid details
5,7-dihydroxy-2-(3-hydroxyphenyl)-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-8-(3,4,5-trihydroxyoxan-2-yl)-4H-chromen-4-one → {6-[5,7-dihydroxy-2-(3-hydroxyphenyl)-4-oxo-8-(3,4,5-trihydroxyoxan-2-yl)-4H-chromen-6-yl]-4,5-dihydroxy-2-(hydroxymethyl)oxan-3-yl}oxidanesulfonic acid details
5,7-dihydroxy-2-(3-hydroxyphenyl)-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-8-(3,4,5-trihydroxyoxan-2-yl)-4H-chromen-4-one → {2-[5,7-dihydroxy-2-(3-hydroxyphenyl)-4-oxo-8-(3,4,5-trihydroxyoxan-2-yl)-4H-chromen-6-yl]-3,5-dihydroxy-6-(hydroxymethyl)oxan-4-yl}oxidanesulfonic acid details
5,7-dihydroxy-2-(3-hydroxyphenyl)-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-8-(3,4,5-trihydroxyoxan-2-yl)-4H-chromen-4-one → {2-[5,7-dihydroxy-2-(3-hydroxyphenyl)-4-oxo-8-(3,4,5-trihydroxyoxan-2-yl)-4H-chromen-6-yl]-4,5-dihydroxy-6-(hydroxymethyl)oxan-3-yl}oxidanesulfonic acid details
6-[(E)-2-(2H-1,3-benzodioxol-5-yl)ethenyl]-5-hydroxy-4-methoxy-5,6-dihydro-2H-pyran-2-one → {2-[(E)-2-(2H-1,3-benzodioxol-5-yl)ethenyl]-4-methoxy-6-oxo-3,6-dihydro-2H-pyran-3-yl}oxidanesulfonic acid details
6-[(E)-2-(2H-1,3-benzodioxol-5-yl)ethenyl]-3-hydroxy-4-methoxyoxan-2-one → {6-[(E)-2-(2H-1,3-benzodioxol-5-yl)ethenyl]-4-methoxy-2-oxooxan-3-yl}oxidanesulfonic acid details
6-[(E)-2-(2H-1,3-benzodioxol-5-yl)ethenyl]-4-hydroxyoxan-2-one → {2-[(E)-2-(2H-1,3-benzodioxol-5-yl)ethenyl]-6-oxooxan-4-yl}oxidanesulfonic acid details
3-[2,4-dihydroxy-3-(3-methylbut-2-en-1-yl)phenyl]-7-hydroxy-8-(4-hydroxy-3-methylbut-2-en-1-yl)-2H-chromen-2-one → [(4-{3-[2,4-dihydroxy-3-(3-methylbut-2-en-1-yl)phenyl]-7-hydroxy-2-oxo-2H-chromen-8-yl}-2-methylbut-2-en-1-yl)oxy]sulfonic acid details
3-[2,4-dihydroxy-3-(4-hydroxy-3-methylbut-2-en-1-yl)phenyl]-7-hydroxy-8-(3-methylbut-2-en-1-yl)-2H-chromen-2-one → [(4-{2,6-dihydroxy-3-[7-hydroxy-8-(3-methylbut-2-en-1-yl)-2-oxo-2H-chromen-3-yl]phenyl}-2-methylbut-2-en-1-yl)oxy]sulfonic acid details
3-{2,4-dihydroxy-3-[(2E)-4-hydroxy-3-methylbut-2-en-1-yl]phenyl}-7-hydroxy-8-(3-methylbut-2-en-1-yl)-2H-chromen-2-one → {[(2E)-4-{2,6-dihydroxy-3-[7-hydroxy-8-(3-methylbut-2-en-1-yl)-2-oxo-2H-chromen-3-yl]phenyl}-2-methylbut-2-en-1-yl]oxy}sulfonic acid details
4-hydroxy-3-(4-hydroxy-3-methylbut-2-en-1-yl)benzoic acid → 4-hydroxy-3-[3-methyl-4-(sulfooxy)but-2-en-1-yl]benzoic acid details
(±)-2-Hydroxy-3-(2-hydroxyphenyl)propanoic acid → 3-(2-hydroxyphenyl)-2-(sulfooxy)propanoic acid details
2,3',4',7,8,11,12,27-octahydroxy-20-(hydroxymethyl)-15,23-dioxo-3,6,9,16,19,22-hexaoxaspiro[heptacyclo[12.10.1.1⁷,²⁴.1¹⁷,²¹.0²,⁸.0⁴,²⁴.0¹⁰,²⁵]heptacosane-5,2'-oxolane]-10(25),11,13-trien-18-yl 3,4,5-trihydroxybenzoate → [2,4',7,8,11,12,27-heptahydroxy-20-(hydroxymethyl)-15,23-dioxo-18-(3,4,5-trihydroxybenzoyloxy)-3,6,9,16,19,22-hexaoxaspiro[heptacyclo[12.10.1.1⁷,²⁴.1¹⁷,²¹.0²,⁸.0⁴,²⁴.0¹⁰,²⁵]heptacosane-5,2'-oxolane]-10(25),11,13-trien-3'-yl]oxidanesulfonic acid details
2,3',4',7,8,11,12,27-octahydroxy-20-(hydroxymethyl)-15,23-dioxo-3,6,9,16,19,22-hexaoxaspiro[heptacyclo[12.10.1.1⁷,²⁴.1¹⁷,²¹.0²,⁸.0⁴,²⁴.0¹⁰,²⁵]heptacosane-5,2'-oxolane]-10(25),11,13-trien-18-yl 3,4,5-trihydroxybenzoate → [2,3',4',7,8,11,12-heptahydroxy-20-(hydroxymethyl)-15,23-dioxo-18-(3,4,5-trihydroxybenzoyloxy)-3,6,9,16,19,22-hexaoxaspiro[heptacyclo[12.10.1.1⁷,²⁴.1¹⁷,²¹.0²,⁸.0⁴,²⁴.0¹⁰,²⁵]heptacosane-5,2'-oxolane]-10(25),11,13-trien-27-yl]oxidanesulfonic acid details
2,3',4',7,8,11,12,27-octahydroxy-20-(hydroxymethyl)-15,23-dioxo-3,6,9,16,19,22-hexaoxaspiro[heptacyclo[12.10.1.1⁷,²⁴.1¹⁷,²¹.0²,⁸.0⁴,²⁴.0¹⁰,²⁵]heptacosane-5,2'-oxolane]-10(25),11,13-trien-18-yl 3,4,5-trihydroxybenzoate → [2,3',7,8,11,12,27-heptahydroxy-20-(hydroxymethyl)-15,23-dioxo-18-(3,4,5-trihydroxybenzoyloxy)-3,6,9,16,19,22-hexaoxaspiro[heptacyclo[12.10.1.1⁷,²⁴.1¹⁷,²¹.0²,⁸.0⁴,²⁴.0¹⁰,²⁵]heptacosane-5,2'-oxolane]-10(25),11,13-trien-4'-yl]oxidanesulfonic acid details
2,3',4',7,8,11,12,18,27-nonahydroxy-20-(hydroxymethyl)-3,6,9,16,19,22-hexaoxaspiro[heptacyclo[12.10.1.1⁷,²⁴.1¹⁷,²¹.0²,⁸.0⁴,²⁴.0¹⁰,²⁵]heptacosane-5,2'-oxolane]-10(25),11,13-triene-15,23-dione → [2,4',7,8,11,12,18,27-octahydroxy-20-(hydroxymethyl)-15,23-dioxo-3,6,9,16,19,22-hexaoxaspiro[heptacyclo[12.10.1.1⁷,²⁴.1¹⁷,²¹.0²,⁸.0⁴,²⁴.0¹⁰,²⁵]heptacosane-5,2'-oxolane]-10(25),11,13-trien-3'-yl]oxidanesulfonic acid details
2,3',4',7,8,11,12,18,27-nonahydroxy-20-(hydroxymethyl)-3,6,9,16,19,22-hexaoxaspiro[heptacyclo[12.10.1.1⁷,²⁴.1¹⁷,²¹.0²,⁸.0⁴,²⁴.0¹⁰,²⁵]heptacosane-5,2'-oxolane]-10(25),11,13-triene-15,23-dione → [2,3',4',7,8,11,12,18-octahydroxy-20-(hydroxymethyl)-15,23-dioxo-3,6,9,16,19,22-hexaoxaspiro[heptacyclo[12.10.1.1⁷,²⁴.1¹⁷,²¹.0²,⁸.0⁴,²⁴.0¹⁰,²⁵]heptacosane-5,2'-oxolane]-10(25),11,13-trien-27-yl]oxidanesulfonic acid details
2,3',4',7,8,11,12,18,27-nonahydroxy-20-(hydroxymethyl)-3,6,9,16,19,22-hexaoxaspiro[heptacyclo[12.10.1.1⁷,²⁴.1¹⁷,²¹.0²,⁸.0⁴,²⁴.0¹⁰,²⁵]heptacosane-5,2'-oxolane]-10(25),11,13-triene-15,23-dione → [2,3',7,8,11,12,18,27-octahydroxy-20-(hydroxymethyl)-15,23-dioxo-3,6,9,16,19,22-hexaoxaspiro[heptacyclo[12.10.1.1⁷,²⁴.1¹⁷,²¹.0²,⁸.0⁴,²⁴.0¹⁰,²⁵]heptacosane-5,2'-oxolane]-10(25),11,13-trien-4'-yl]oxidanesulfonic acid details
2-[5-hydroxy-2-(8-hydroxy-3,7-dimethylocta-2,6-dien-1-yl)-3-methoxyphenyl]-1-benzofuran-6-ol → ({8-[4-hydroxy-2-(6-hydroxy-1-benzofuran-2-yl)-6-methoxyphenyl]-2,6-dimethylocta-2,6-dien-1-yl}oxy)sulfonic acid details
2-{5-hydroxy-2-[4-hydroxy-3-(4-methylpent-3-en-1-yl)but-2-en-1-yl]-3-methoxyphenyl}-1-benzofuran-6-ol → [(2-{2-[4-hydroxy-2-(6-hydroxy-1-benzofuran-2-yl)-6-methoxyphenyl]ethylidene}-6-methylhept-5-en-1-yl)oxy]sulfonic acid details
2-[5-hydroxy-2-(4-hydroxy-3,7-dimethylocta-2,6-dien-1-yl)-3-methoxyphenyl]-1-benzofuran-6-ol → ({1-[4-hydroxy-2-(6-hydroxy-1-benzofuran-2-yl)-6-methoxyphenyl]-3,7-dimethylocta-2,6-dien-4-yl}oxy)sulfonic acid details
2-[5-hydroxy-2-(5-hydroxy-3,7-dimethylocta-2,6-dien-1-yl)-3-methoxyphenyl]-1-benzofuran-6-ol → ({8-[4-hydroxy-2-(6-hydroxy-1-benzofuran-2-yl)-6-methoxyphenyl]-2,6-dimethylocta-2,6-dien-4-yl}oxy)sulfonic acid details
4,5-dihydroxy-11,15-dimethoxy-6,8,20-trioxapentacyclo[10.8.0.0²,⁹.0³,⁷.0¹⁴,¹⁹]icosa-1(12),2(9),10,14,16,18-hexaen-13-one → {5-hydroxy-11,15-dimethoxy-13-oxo-6,8,20-trioxapentacyclo[10.8.0.0²,⁹.0³,⁷.0¹⁴,¹⁹]icosa-1(12),2(9),10,14,16,18-hexaen-4-yl}oxidanesulfonic acid details
Decarbamoylneosaxitoxin → ({5,10,10-trihydroxy-2,6-diimino-decahydropyrrolo[1,2-c]purin-4-yl}methoxy)sulfonic acid details
15-(4-hydroxy-3-methylbut-2-en-1-yl)-8,17-dioxatetracyclo[8.7.0.0²,⁷.0¹¹,¹⁶]heptadeca-2(7),3,5,11(16),12,14-hexaene-5,14-diol → [(4-{5,14-dihydroxy-8,17-dioxatetracyclo[8.7.0.0²,⁷.0¹¹,¹⁶]heptadeca-2(7),3,5,11(16),12,14-hexaen-15-yl}-2-methylbut-2-en-1-yl)oxy]sulfonic acid details
15-[(2E)-4-hydroxy-3-methylbut-2-en-1-yl]-8,17-dioxatetracyclo[8.7.0.0²,⁷.0¹¹,¹⁶]heptadeca-2(7),3,5,11(16),12,14-hexaene-5,14-diol → {[(2E)-4-{5,14-dihydroxy-8,17-dioxatetracyclo[8.7.0.0²,⁷.0¹¹,¹⁶]heptadeca-2(7),3,5,11(16),12,14-hexaen-15-yl}-2-methylbut-2-en-1-yl]oxy}sulfonic acid details
4-[8-(hydroxymethyl)-8-methyl-2H,3H,4H,8H-pyrano[2,3-f]chromen-3-yl]-3-methoxyphenol → {[3-(4-hydroxy-2-methoxyphenyl)-8-methyl-2H,3H,4H,8H-pyrano[2,3-f]chromen-8-yl]methoxy}sulfonic acid details
3-(4-hydroxy-2-methoxyphenyl)-8,8-dimethyl-2H,3H,4H,8H-pyrano[2,3-f]chromen-4-ol → [3-(4-hydroxy-2-methoxyphenyl)-8,8-dimethyl-2H,3H,4H,8H-pyrano[2,3-f]chromen-4-yl]oxidanesulfonic acid details
2-[8-(hydroxymethyl)-8-methyl-2H,3H,4H,8H-pyrano[2,3-f]chromen-3-yl]-5-methoxyphenol → {[3-(2-hydroxy-4-methoxyphenyl)-8-methyl-2H,3H,4H,8H-pyrano[2,3-f]chromen-8-yl]methoxy}sulfonic acid details
3-(2-hydroxy-4-methoxyphenyl)-8,8-dimethyl-2H,3H,4H,8H-pyrano[2,3-f]chromen-4-ol → [3-(2-hydroxy-4-methoxyphenyl)-8,8-dimethyl-2H,3H,4H,8H-pyrano[2,3-f]chromen-4-yl]oxidanesulfonic acid details
Pyranomammea C → [5-hydroxy-2,2-dimethyl-10-(3-methylbutanoyl)-8-oxo-6-propyl-2H,3H,4H,8H-pyrano[3,2-g]chromen-3-yl]oxidanesulfonic acid details
6-({[3,4-dihydroxy-4-(hydroxymethyl)oxolan-2-yl]oxy}methyl)oxane-2,3,4,5-tetrol → ({3,4-dihydroxy-5-[(3,4,5,6-tetrahydroxyoxan-2-yl)methoxy]oxolan-3-yl}methoxy)sulfonic acid details
6-({[3,4-dihydroxy-4-(hydroxymethyl)oxolan-2-yl]oxy}methyl)oxane-2,3,4,5-tetrol → [4-hydroxy-4-(hydroxymethyl)-2-[(3,4,5,6-tetrahydroxyoxan-2-yl)methoxy]oxolan-3-yl]oxidanesulfonic acid details
3-(3-Hydroxyphenyl)-3-hydroxypropanoic acid → 3-(3-hydroxyphenyl)-3-(sulfooxy)propanoic acid details
2-hydroxy-3-(3-hydroxyphenyl)propanoic acid → 3-(3-hydroxyphenyl)-2-(sulfooxy)propanoic acid details
D-Phenyllactic acid → (2S)-3-phenyl-2-(sulfooxy)propanoic acid details
Phenyllactic acid → 3-phenyl-2-(sulfooxy)propanoic acid details
Vanillactic acid → 3-(4-hydroxy-3-methoxyphenyl)-2-(sulfooxy)propanoic acid details
4-Hydroxy-5-(3-hydroxyphenyl)pentanoic acid → 5-(3-hydroxyphenyl)-4-(sulfooxy)pentanoic acid details
3-(3,4-Dihydroxyphenyl)lactic acid → 3-(3,4-dihydroxyphenyl)-2-(sulfooxy)propanoic acid details
1-Hydroxyibuprofen → 2-{4-[2-methyl-1-(sulfooxy)propyl]phenyl}propanoic acid details
3-hydroxy-2-[4-(2-methylpropyl)phenyl]propanoic acid → 2-[4-(2-methylpropyl)phenyl]-3-(sulfooxy)propanoic acid details
3-Hydroxyibuprofen → 2-{4-[2-methyl-3-(sulfooxy)propyl]phenyl}propanoic acid details
4-hydroxy-3-(2-hydroxy-3-oxo-1-phenylbutyl)-2H-chromen-2-one → {[1-(4-hydroxy-2-oxo-2H-chromen-3-yl)-3-oxo-1-phenylbutan-2-yl]oxy}sulfonic acid details
4-hydroxy-3-(4-hydroxy-3-oxo-1-phenylbutyl)-2H-chromen-2-one → [4-(4-hydroxy-2-oxo-2H-chromen-3-yl)-2-oxo-4-phenylbutoxy]sulfonic acid details
4-hydroxy-3-(3-hydroxy-1-phenylbutyl)-2H-chromen-2-one → {[4-(4-hydroxy-2-oxo-2H-chromen-3-yl)-4-phenylbutan-2-yl]oxy}sulfonic acid details
4-hydroxy-3-phenylbutanoic acid → 3-phenyl-4-(sulfooxy)butanoic acid details
2-hydroxy-3-phenylbutanoic acid → 3-phenyl-2-(sulfooxy)butanoic acid details
3-hydroxy-3-(4-methoxyphenyl)propanoic acid → 3-(4-methoxyphenyl)-3-(sulfooxy)propanoic acid details
2-Hydroxy-3-(4-methoxyphenyl)propanoic acid → 3-(4-methoxyphenyl)-2-(sulfooxy)propanoic acid details
Tamarixetin → [5,7-dihydroxy-2-(3-hydroxy-4-methoxyphenyl)-4-oxo-3,4-dihydro-2H-1-benzopyran-3-yl]oxidanesulfonic acid details
5-[2-hydroxy-3-(2,4,6-trihydroxyphenyl)propyl]benzene-1,2,3-triol → {[1-(2,4,6-trihydroxyphenyl)-3-(3,4,5-trihydroxyphenyl)propan-2-yl]oxy}sulfonic acid details
4-hydroxy-5-(3,4,5-trihydroxyphenyl)pentanoic acid → 4-(sulfooxy)-5-(3,4,5-trihydroxyphenyl)pentanoic acid details
2-[3-(3,5-dihydroxyphenyl)-2-hydroxypropyl]benzene-1,3,5-triol → {[1-(3,5-dihydroxyphenyl)-3-(2,4,6-trihydroxyphenyl)propan-2-yl]oxy}sulfonic acid details
5-(3,5-dihydroxyphenyl)-4-hydroxypentanoic acid → 5-(3,5-dihydroxyphenyl)-4-(sulfooxy)pentanoic acid details
2-hydroxy-3-(3,4,5-trihydroxyphenyl)propanoic acid → 2-(sulfooxy)-3-(3,4,5-trihydroxyphenyl)propanoic acid details
4-[(1E)-3-hydroxyprop-1-en-1-yl]benzene-1,2-diol → {[(2E)-3-(3,4-dihydroxyphenyl)prop-2-en-1-yl]oxy}sulfonic acid details
4-[3-(hydroxymethyl)oxiran-2-yl]phenol → {[3-(4-hydroxyphenyl)oxiran-2-yl]methoxy}sulfonic acid details
4-[1-hydroxy-2-(4-hydroxyphenyl)propyl]benzene-1,3-diol → [1-(2,4-dihydroxyphenyl)-2-(4-hydroxyphenyl)propoxy]sulfonic acid details
1-(2,4-dihydroxyphenyl)-3-hydroxy-2-(4-hydroxyphenyl)propan-1-one → [3-(2,4-dihydroxyphenyl)-2-(4-hydroxyphenyl)-3-oxopropoxy]sulfonic acid details
3-(4-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-4,7-diol → [7-hydroxy-3-(4-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-yl]oxidanesulfonic acid details
3-phenyl-3,4-dihydro-2H-1-benzopyran-4,7-diol → (7-hydroxy-3-phenyl-3,4-dihydro-2H-1-benzopyran-4-yl)oxidanesulfonic acid details
3,4,5-trihydroxy-2,8-bis(3,5,7-trihydroxy-3,4-dihydro-2H-1-benzopyran-2-yl)-6H-benzo[7]annulen-6-one → {5,7-dihydroxy-2-[3,4,5-trihydroxy-6-oxo-8-(3,5,7-trihydroxy-3,4-dihydro-2H-1-benzopyran-2-yl)-6H-benzo[7]annulen-2-yl]-3,4-dihydro-2H-1-benzopyran-3-yl}oxidanesulfonic acid details
3,4,5-trihydroxy-2,8-bis(3,5,7-trihydroxy-3,4-dihydro-2H-1-benzopyran-2-yl)-6H-benzo[7]annulen-6-one → {5,7-dihydroxy-2-[3,4,5-trihydroxy-6-oxo-2-(3,5,7-trihydroxy-3,4-dihydro-2H-1-benzopyran-2-yl)-6H-benzo[7]annulen-8-yl]-3,4-dihydro-2H-1-benzopyran-3-yl}oxidanesulfonic acid details
6,7,8,11,12,13,20,21,22-nonahydroxy-2,17,19-trioxatetracyclo[16.3.1.0⁴,⁹.0¹⁰,¹⁵]docosa-4,6,8,10,12,14-hexaene-3,16-dione → {6,7,8,11,12,13,20,21-octahydroxy-3,16-dioxo-2,17,19-trioxatetracyclo[16.3.1.0⁴,⁹.0¹⁰,¹⁵]docosa-4,6,8,10,12,14-hexaen-22-yl}oxidanesulfonic acid details
6,7,8,11,12,13,20,21,22-nonahydroxy-2,17,19-trioxatetracyclo[16.3.1.0⁴,⁹.0¹⁰,¹⁵]docosa-4,6,8,10,12,14-hexaene-3,16-dione → {6,7,8,11,12,13,20,22-octahydroxy-3,16-dioxo-2,17,19-trioxatetracyclo[16.3.1.0⁴,⁹.0¹⁰,¹⁵]docosa-4,6,8,10,12,14-hexaen-21-yl}oxidanesulfonic acid details
2-[3,4-bis(2-hydroxyethoxy)phenyl]-3,5-dihydroxy-7-(2-hydroxyethoxy)-4H-chromen-4-one → (2-{4-[3,5-dihydroxy-7-(2-hydroxyethoxy)-4-oxo-4H-chromen-2-yl]-2-(2-hydroxyethoxy)phenoxy}ethoxy)sulfonic acid details
2-[3,4-bis(2-hydroxyethoxy)phenyl]-3,5-dihydroxy-7-(2-hydroxyethoxy)-4H-chromen-4-one → (2-{5-[3,5-dihydroxy-7-(2-hydroxyethoxy)-4-oxo-4H-chromen-2-yl]-2-(2-hydroxyethoxy)phenoxy}ethoxy)sulfonic acid details
2-[3,4-bis(2-hydroxyethoxy)phenyl]-3,5-dihydroxy-7-(2-hydroxyethoxy)-4H-chromen-4-one → [2-({2-[3,4-bis(2-hydroxyethoxy)phenyl]-3,5-dihydroxy-4-oxo-4H-chromen-7-yl}oxy)ethoxy]sulfonic acid details
2-[3,4-bis(2-hydroxyethoxy)phenyl]-5-hydroxy-7-(2-hydroxyethoxy)-3-{[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxy}-4H-chromen-4-one → (2-{4-[5-hydroxy-7-(2-hydroxyethoxy)-4-oxo-3-{[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxy}-4H-chromen-2-yl]-2-(2-hydroxyethoxy)phenoxy}ethoxy)sulfonic acid details
2-[3,4-bis(2-hydroxyethoxy)phenyl]-5-hydroxy-7-(2-hydroxyethoxy)-3-{[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxy}-4H-chromen-4-one → (2-{5-[5-hydroxy-7-(2-hydroxyethoxy)-4-oxo-3-{[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxy}-4H-chromen-2-yl]-2-(2-hydroxyethoxy)phenoxy}ethoxy)sulfonic acid details
2-[3,4-bis(2-hydroxyethoxy)phenyl]-5-hydroxy-7-(2-hydroxyethoxy)-3-{[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxy}-4H-chromen-4-one → [2-({2-[3,4-bis(2-hydroxyethoxy)phenyl]-5-hydroxy-4-oxo-3-{[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxy}-4H-chromen-7-yl}oxy)ethoxy]sulfonic acid details
2-[3,4-bis(2-hydroxyethoxy)phenyl]-3,5,6-trihydroxy-7-(2-hydroxyethoxy)-4H-chromen-4-one → {2-[2-(2-hydroxyethoxy)-4-[3,5,6-trihydroxy-7-(2-hydroxyethoxy)-4-oxo-4H-chromen-2-yl]phenoxy]ethoxy}sulfonic acid details
2-[3,4-bis(2-hydroxyethoxy)phenyl]-3,5,6-trihydroxy-7-(2-hydroxyethoxy)-4H-chromen-4-one → {2-[2-(2-hydroxyethoxy)-5-[3,5,6-trihydroxy-7-(2-hydroxyethoxy)-4-oxo-4H-chromen-2-yl]phenoxy]ethoxy}sulfonic acid details
2-[3,4-bis(2-hydroxyethoxy)phenyl]-3,5,6-trihydroxy-7-(2-hydroxyethoxy)-4H-chromen-4-one → [2-({2-[3,4-bis(2-hydroxyethoxy)phenyl]-3,5,6-trihydroxy-4-oxo-4H-chromen-7-yl}oxy)ethoxy]sulfonic acid details
3,5-dihydroxy-2-[4-hydroxy-3-(2-hydroxyethoxy)phenyl]-7-(2-hydroxyethoxy)-4H-chromen-4-one → (2-{5-[3,5-dihydroxy-7-(2-hydroxyethoxy)-4-oxo-4H-chromen-2-yl]-2-hydroxyphenoxy}ethoxy)sulfonic acid details
3,5-dihydroxy-2-[4-hydroxy-3-(2-hydroxyethoxy)phenyl]-7-(2-hydroxyethoxy)-4H-chromen-4-one → [2-({3,5-dihydroxy-2-[4-hydroxy-3-(2-hydroxyethoxy)phenyl]-4-oxo-4H-chromen-7-yl}oxy)ethoxy]sulfonic acid details
Glycolaldehyde → (2-oxoethoxy)sulfonic acid details
3,5-dihydroxy-2-[3-hydroxy-4-(2-hydroxyethoxy)phenyl]-7-(2-hydroxyethoxy)-4H-chromen-4-one → (2-{4-[3,5-dihydroxy-7-(2-hydroxyethoxy)-4-oxo-4H-chromen-2-yl]-2-hydroxyphenoxy}ethoxy)sulfonic acid details
3,5-dihydroxy-2-[3-hydroxy-4-(2-hydroxyethoxy)phenyl]-7-(2-hydroxyethoxy)-4H-chromen-4-one → [2-({3,5-dihydroxy-2-[3-hydroxy-4-(2-hydroxyethoxy)phenyl]-4-oxo-4H-chromen-7-yl}oxy)ethoxy]sulfonic acid details
2-[3,4-bis(2-hydroxyethoxy)phenyl]-3,5,7-trihydroxy-4H-chromen-4-one → {2-[2-(2-hydroxyethoxy)-4-(3,5,7-trihydroxy-4-oxo-4H-chromen-2-yl)phenoxy]ethoxy}sulfonic acid details
2-[3,4-bis(2-hydroxyethoxy)phenyl]-3,5,7-trihydroxy-4H-chromen-4-one → {2-[2-(2-hydroxyethoxy)-5-(3,5,7-trihydroxy-4-oxo-4H-chromen-2-yl)phenoxy]ethoxy}sulfonic acid details
2-{4-[3,5-dihydroxy-7-(2-hydroxyethoxy)-4-oxo-4H-chromen-2-yl]-2-(2-hydroxyethoxy)phenoxy}acetaldehyde → (2-{5-[3,5-dihydroxy-7-(2-hydroxyethoxy)-4-oxo-4H-chromen-2-yl]-2-(2-oxoethoxy)phenoxy}ethoxy)sulfonic acid details
2-{4-[3,5-dihydroxy-7-(2-hydroxyethoxy)-4-oxo-4H-chromen-2-yl]-2-(2-hydroxyethoxy)phenoxy}acetaldehyde → [2-({3,5-dihydroxy-2-[3-(2-hydroxyethoxy)-4-(2-oxoethoxy)phenyl]-4-oxo-4H-chromen-7-yl}oxy)ethoxy]sulfonic acid details
2-{5-[3,5-dihydroxy-7-(2-hydroxyethoxy)-4-oxo-4H-chromen-2-yl]-2-(2-hydroxyethoxy)phenoxy}acetaldehyde → (2-{4-[3,5-dihydroxy-7-(2-hydroxyethoxy)-4-oxo-4H-chromen-2-yl]-2-(2-oxoethoxy)phenoxy}ethoxy)sulfonic acid details
2-{5-[3,5-dihydroxy-7-(2-hydroxyethoxy)-4-oxo-4H-chromen-2-yl]-2-(2-hydroxyethoxy)phenoxy}acetaldehyde → [2-({3,5-dihydroxy-2-[4-(2-hydroxyethoxy)-3-(2-oxoethoxy)phenyl]-4-oxo-4H-chromen-7-yl}oxy)ethoxy]sulfonic acid details
2-({2-[3,4-bis(2-hydroxyethoxy)phenyl]-3,5-dihydroxy-4-oxo-4H-chromen-7-yl}oxy)acetaldehyde → (2-{4-[3,5-dihydroxy-4-oxo-7-(2-oxoethoxy)-4H-chromen-2-yl]-2-(2-hydroxyethoxy)phenoxy}ethoxy)sulfonic acid details
2-({2-[3,4-bis(2-hydroxyethoxy)phenyl]-3,5-dihydroxy-4-oxo-4H-chromen-7-yl}oxy)acetaldehyde → (2-{5-[3,5-dihydroxy-4-oxo-7-(2-oxoethoxy)-4H-chromen-2-yl]-2-(2-hydroxyethoxy)phenoxy}ethoxy)sulfonic acid details
3,5-dihydroxy-7-(2-hydroxyethoxy)-2-[3-(2-hydroxyethoxy)phenyl]-4H-chromen-4-one → (2-{3-[3,5-dihydroxy-7-(2-hydroxyethoxy)-4-oxo-4H-chromen-2-yl]phenoxy}ethoxy)sulfonic acid details
3,5-dihydroxy-7-(2-hydroxyethoxy)-2-[3-(2-hydroxyethoxy)phenyl]-4H-chromen-4-one → [2-({3,5-dihydroxy-2-[3-(2-hydroxyethoxy)phenyl]-4-oxo-4H-chromen-7-yl}oxy)ethoxy]sulfonic acid details
2-[3,4-bis(2-hydroxyethoxy)phenyl]-3,5,7-trihydroxy-3,4-dihydro-2H-1-benzopyran-4-one → {2-[2-(2-hydroxyethoxy)-4-(3,5,7-trihydroxy-4-oxo-3,4-dihydro-2H-1-benzopyran-2-yl)phenoxy]ethoxy}sulfonic acid details
2-[3,4-bis(2-hydroxyethoxy)phenyl]-3,5,7-trihydroxy-3,4-dihydro-2H-1-benzopyran-4-one → {2-[2-(2-hydroxyethoxy)-5-(3,5,7-trihydroxy-4-oxo-3,4-dihydro-2H-1-benzopyran-2-yl)phenoxy]ethoxy}sulfonic acid details
2-[3,4-bis(2-hydroxyethoxy)phenyl]-3,5,7-trihydroxy-3,4-dihydro-2H-1-benzopyran-4-one → {2-[3,4-bis(2-hydroxyethoxy)phenyl]-5,7-dihydroxy-4-oxo-3,4-dihydro-2H-1-benzopyran-3-yl}oxidanesulfonic acid details
3-[3,4-bis(2-hydroxyethoxy)phenyl]-1-(2,4,6-trihydroxyphenyl)propane-1,2-dione → (2-{4-[2,3-dioxo-3-(2,4,6-trihydroxyphenyl)propyl]-2-(2-hydroxyethoxy)phenoxy}ethoxy)sulfonic acid details
3-[3,4-bis(2-hydroxyethoxy)phenyl]-1-(2,4,6-trihydroxyphenyl)propane-1,2-dione → (2-{5-[2,3-dioxo-3-(2,4,6-trihydroxyphenyl)propyl]-2-(2-hydroxyethoxy)phenoxy}ethoxy)sulfonic acid details
3-[3,4-bis(2-hydroxyethoxy)phenyl]-2-oxopropanoic acid → 3-[3-(2-hydroxyethoxy)-4-[2-(sulfooxy)ethoxy]phenyl]-2-oxopropanoic acid details
3-[3,4-bis(2-hydroxyethoxy)phenyl]-2-oxopropanoic acid → 3-[4-(2-hydroxyethoxy)-3-[2-(sulfooxy)ethoxy]phenyl]-2-oxopropanoic acid details
2-{4-[3,5-dihydroxy-7-(2-hydroxyethoxy)-4-oxo-4H-chromen-2-yl]-2-(2-hydroxyethoxy)phenoxy}acetic acid → 2-{4-[3,5-dihydroxy-7-(2-hydroxyethoxy)-4-oxo-4H-chromen-2-yl]-2-[2-(sulfooxy)ethoxy]phenoxy}acetic acid details
2-{4-[3,5-dihydroxy-7-(2-hydroxyethoxy)-4-oxo-4H-chromen-2-yl]-2-(2-hydroxyethoxy)phenoxy}acetic acid → 2-(4-{3,5-dihydroxy-4-oxo-7-[2-(sulfooxy)ethoxy]-4H-chromen-2-yl}-2-(2-hydroxyethoxy)phenoxy)acetic acid details
2-{5-[3,5-dihydroxy-7-(2-hydroxyethoxy)-4-oxo-4H-chromen-2-yl]-2-(2-hydroxyethoxy)phenoxy}acetic acid → 2-{5-[3,5-dihydroxy-7-(2-hydroxyethoxy)-4-oxo-4H-chromen-2-yl]-2-[2-(sulfooxy)ethoxy]phenoxy}acetic acid details
2-{5-[3,5-dihydroxy-7-(2-hydroxyethoxy)-4-oxo-4H-chromen-2-yl]-2-(2-hydroxyethoxy)phenoxy}acetic acid → 2-(5-{3,5-dihydroxy-4-oxo-7-[2-(sulfooxy)ethoxy]-4H-chromen-2-yl}-2-(2-hydroxyethoxy)phenoxy)acetic acid details
2-({2-[3,4-bis(2-hydroxyethoxy)phenyl]-3,5-dihydroxy-4-oxo-4H-chromen-7-yl}oxy)acetic acid → 2-({3,5-dihydroxy-2-[3-(2-hydroxyethoxy)-4-[2-(sulfooxy)ethoxy]phenyl]-4-oxo-4H-chromen-7-yl}oxy)acetic acid details
2-({2-[3,4-bis(2-hydroxyethoxy)phenyl]-3,5-dihydroxy-4-oxo-4H-chromen-7-yl}oxy)acetic acid → 2-({3,5-dihydroxy-2-[4-(2-hydroxyethoxy)-3-[2-(sulfooxy)ethoxy]phenyl]-4-oxo-4H-chromen-7-yl}oxy)acetic acid details
(3R,8S)-15-hydroxy-12-methoxy-5,7,9,20-tetraoxahexacyclo[11.7.0.0²,¹⁰.0³,⁸.0⁴,⁶.0¹⁴,¹⁸]icosa-1(13),2(10),11,14(18)-tetraene-17,19-dione → {12-methoxy-17,19-dioxo-5,7,9,20-tetraoxahexacyclo[11.7.0.0²,¹⁰.0³,⁸.0⁴,⁶.0¹⁴,¹⁸]icosa-1(13),2(10),11,14(18)-tetraen-15-yl}oxidanesulfonic acid details
(3R,8S)-17-hydroxy-12-methoxy-5,7,9,20-tetraoxahexacyclo[11.7.0.0²,¹⁰.0³,⁸.0⁴,⁶.0¹⁴,¹⁸]icosa-1(13),2(10),11,14(18)-tetraen-19-one → {12-methoxy-19-oxo-5,7,9,20-tetraoxahexacyclo[11.7.0.0²,¹⁰.0³,⁸.0⁴,⁶.0¹⁴,¹⁸]icosa-1(13),2(10),11,14(18)-tetraen-17-yl}oxidanesulfonic acid details
3-hydroxy-3-(2,3,4-trimethoxyphenyl)propanoic acid → 3-(sulfooxy)-3-(2,3,4-trimethoxyphenyl)propanoic acid details
2-hydroxy-3-(2,3,4-trimethoxyphenyl)propanoic acid → 2-(sulfooxy)-3-(2,3,4-trimethoxyphenyl)propanoic acid details
Tropate → 2-phenyl-3-(sulfooxy)propanoic acid details
3-hydroxy-3-(3-methoxyphenyl)propanoic acid → 3-(3-methoxyphenyl)-3-(sulfooxy)propanoic acid details
2-hydroxy-3-(3-methoxyphenyl)propanoic acid → 3-(3-methoxyphenyl)-2-(sulfooxy)propanoic acid details
1-(2-hydroxyphenyl)-2-phenylethane-1,2-diol → [2-hydroxy-2-(2-hydroxyphenyl)-1-phenylethoxy]sulfonic acid details
1-(2-hydroxyphenyl)-2-phenylethane-1,2-diol → [2-hydroxy-1-(2-hydroxyphenyl)-2-phenylethoxy]sulfonic acid details
1-(3-hydroxyphenyl)-2-phenylethane-1,2-diol → [2-hydroxy-2-(3-hydroxyphenyl)-1-phenylethoxy]sulfonic acid details
1-(3-hydroxyphenyl)-2-phenylethane-1,2-diol → [2-hydroxy-1-(3-hydroxyphenyl)-2-phenylethoxy]sulfonic acid details
1-(4-hydroxyphenyl)-2-phenylethane-1,2-diol → [2-hydroxy-2-(4-hydroxyphenyl)-1-phenylethoxy]sulfonic acid details
1-(4-hydroxyphenyl)-2-phenylethane-1,2-diol → [2-hydroxy-1-(4-hydroxyphenyl)-2-phenylethoxy]sulfonic acid details
2-[hydroxy(phenyl)methyl]butanedioic acid → 2-[phenyl(sulfooxy)methyl]butanedioic acid details
2-benzyl-3-hydroxybutanedioic acid → 2-benzyl-3-(sulfooxy)butanedioic acid details
2-[hydroxy(phenyl)methyl]propanedioic acid → 2-[phenyl(sulfooxy)methyl]propanedioic acid details
2-cyano-3-(3,4-dihydroxy-5-nitrophenyl)-N-ethyl-N-(2-hydroxyethyl)prop-2-enamide → {2-[2-cyano-3-(3,4-dihydroxy-5-nitrophenyl)-N-ethylprop-2-enamido]ethoxy}sulfonic acid details
2-cyano-3-(3,4-dihydroxy-5-nitrophenyl)-N,N-diethyl-3-hydroxypropanamide → [2-cyano-2-(diethylcarbamoyl)-1-(3,4-dihydroxy-5-nitrophenyl)ethoxy]sulfonic acid details
2-cyano-3-(3,4-dihydroxy-5-nitrophenyl)-N-ethyl-N-(2-hydroxyethyl)propanamide → (2-{2-cyano-2-[(3,4-dihydroxy-5-nitrophenyl)methyl]-N-ethylacetamido}ethoxy)sulfonic acid details
2,3-Dihydroxybutanedioic acid → 2-hydroxy-3-(sulfooxy)butanedioic acid details
2-(3,4-dihydroxyphenyl)-8-[(1S)-3-(3,4-dihydroxyphenyl)-2-hydroxy-1-(2,4,6-trihydroxyphenyl)propyl]-3,4-dihydro-2H-1-benzopyran-3,5,7-triol → {[3-(3,4-dihydroxyphenyl)-1-[2-(3,4-dihydroxyphenyl)-3,5,7-trihydroxy-3,4-dihydro-2H-1-benzopyran-8-yl]-1-(2,4,6-trihydroxyphenyl)propan-2-yl]oxy}sulfonic acid details
(4S)-2-(3,4-dihydroxyphenyl)-4-[3,5,7-trihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-8-yl]-3,4-dihydro-2H-1-benzopyran-3,5,7-triol → [2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-4-[3,5,7-trihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-8-yl]-3,4-dihydro-2H-1-benzopyran-3-yl]oxidanesulfonic acid details
(4S)-4-[2-(3,4-dihydroxyphenyl)-3,5,7-trihydroxy-3,4-dihydro-2H-1-benzopyran-8-yl]-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-3,5,7-triol → {4-[2-(3,4-dihydroxyphenyl)-3,5,7-trihydroxy-3,4-dihydro-2H-1-benzopyran-8-yl]-5,7-dihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-3-yl}oxidanesulfonic acid details
8-[3-(3,4-dihydroxyphenyl)-2-hydroxy-1-(2,4,6-trihydroxyphenyl)propyl]-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-3,5,7-triol → {[3-(3,4-dihydroxyphenyl)-1-[3,5,7-trihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-8-yl]-1-(2,4,6-trihydroxyphenyl)propan-2-yl]oxy}sulfonic acid details
2-(3,4-dihydroxyphenyl)-8-[2-hydroxy-3-(3-hydroxyphenyl)-1-(2,4,6-trihydroxyphenyl)propyl]-3,4-dihydro-2H-1-benzopyran-3,5,7-triol → ({1-[2-(3,4-dihydroxyphenyl)-3,5,7-trihydroxy-3,4-dihydro-2H-1-benzopyran-8-yl]-3-(3-hydroxyphenyl)-1-(2,4,6-trihydroxyphenyl)propan-2-yl}oxy)sulfonic acid details
2-(3-hydroxyphenyl)-4-[3,5,7-trihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-8-yl]-3,4-dihydro-2H-1-benzopyran-3,5,7-triol → [5,7-dihydroxy-2-(3-hydroxyphenyl)-4-[3,5,7-trihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-8-yl]-3,4-dihydro-2H-1-benzopyran-3-yl]oxidanesulfonic acid details
8-[2-hydroxy-3-(3-hydroxyphenyl)-1-(2,4,6-trihydroxyphenyl)propyl]-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-3,5,7-triol → {[3-(3-hydroxyphenyl)-1-[3,5,7-trihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-8-yl]-1-(2,4,6-trihydroxyphenyl)propan-2-yl]oxy}sulfonic acid details
(3Z)-4-{4-[2-(methylamino)ethoxy]phenyl}-3,4-diphenylbut-3-en-2-ol → {[(3Z)-4-{4-[2-(methylamino)ethoxy]phenyl}-3,4-diphenylbut-3-en-2-yl]oxy}sulfonic acid details
(3E)-4-{4-[2-(methylamino)ethoxy]phenyl}-3,4-diphenylbut-3-en-1-ol → {[(3E)-4-{4-[2-(methylamino)ethoxy]phenyl}-3,4-diphenylbut-3-en-1-yl]oxy}sulfonic acid details
2-(methylamino)ethan-1-ol → [2-(methylamino)ethoxy]sulfonic acid details
2-{4-[(1E)-1,2-diphenylbut-1-en-1-yl]phenoxy}ethan-1-ol → (2-{4-[(1E)-1,2-diphenylbut-1-en-1-yl]phenoxy}ethoxy)sulfonic acid details
3-[(1Z)-1-{4-[2-(dimethylamino)ethoxy]phenyl}-3-hydroxy-2-phenylbut-1-en-1-yl]phenol → {[(3Z)-4-{4-[2-(dimethylamino)ethoxy]phenyl}-4-(3-hydroxyphenyl)-3-phenylbut-3-en-2-yl]oxy}sulfonic acid details
3-[(1E)-1-{4-[2-(dimethylamino)ethoxy]phenyl}-4-hydroxy-2-phenylbut-1-en-1-yl]phenol → {[(3E)-4-{4-[2-(dimethylamino)ethoxy]phenyl}-4-(3-hydroxyphenyl)-3-phenylbut-3-en-1-yl]oxy}sulfonic acid details
Dimethylethanolamine → [2-(dimethylamino)ethoxy]sulfonic acid details
R-10-Hydroxywarfarin → {[(1R)-1-(2-hydroxy-4-oxo-4H-chromen-3-yl)-3-oxo-1-phenylbutan-2-yl]oxy}sulfonic acid details
2-hydroxy-3-[(1R)-2-hydroxy-1-(2-hydroxyphenyl)-3-oxobutyl]-4H-chromen-4-one → {[1-(2-hydroxy-4-oxo-4H-chromen-3-yl)-1-(2-hydroxyphenyl)-3-oxobutan-2-yl]oxy}sulfonic acid details
2,6-dihydroxy-3-[(1R)-2-hydroxy-3-oxo-1-phenylbutyl]-4H-chromen-4-one → {[1-(2,6-dihydroxy-4-oxo-4H-chromen-3-yl)-3-oxo-1-phenylbutan-2-yl]oxy}sulfonic acid details
2,7-dihydroxy-3-[(1R)-2-hydroxy-3-oxo-1-phenylbutyl]-4H-chromen-4-one → {[1-(2,7-dihydroxy-4-oxo-4H-chromen-3-yl)-3-oxo-1-phenylbutan-2-yl]oxy}sulfonic acid details
2-hydroxy-3-[(1R)-2-hydroxy-1-(4-hydroxyphenyl)-3-oxobutyl]-4H-chromen-4-one → {[1-(2-hydroxy-4-oxo-4H-chromen-3-yl)-1-(4-hydroxyphenyl)-3-oxobutan-2-yl]oxy}sulfonic acid details
2,8-dihydroxy-3-[(1R)-2-hydroxy-3-oxo-1-phenylbutyl]-4H-chromen-4-one → {[1-(2,8-dihydroxy-4-oxo-4H-chromen-3-yl)-3-oxo-1-phenylbutan-2-yl]oxy}sulfonic acid details
2,5-dihydroxy-3-[(1R)-2-hydroxy-3-oxo-1-phenylbutyl]-4H-chromen-4-one → {[1-(2,5-dihydroxy-4-oxo-4H-chromen-3-yl)-3-oxo-1-phenylbutan-2-yl]oxy}sulfonic acid details
3-[(1R)-2,4-dihydroxy-3-oxo-1-phenylbutyl]-2-hydroxy-4H-chromen-4-one → [3-hydroxy-4-(2-hydroxy-4-oxo-4H-chromen-3-yl)-2-oxo-4-phenylbutoxy]sulfonic acid details
3-[(1R)-2,4-dihydroxy-3-oxo-1-phenylbutyl]-2-hydroxy-4H-chromen-4-one → {[4-hydroxy-1-(2-hydroxy-4-oxo-4H-chromen-3-yl)-3-oxo-1-phenylbutan-2-yl]oxy}sulfonic acid details
3-[(1R)-2,3-dihydroxy-1-phenylbutyl]-2-hydroxy-4H-chromen-4-one → {[3-hydroxy-4-(2-hydroxy-4-oxo-4H-chromen-3-yl)-4-phenylbutan-2-yl]oxy}sulfonic acid details
3-[(1R)-2,3-dihydroxy-1-phenylbutyl]-2-hydroxy-4H-chromen-4-one → {[3-hydroxy-1-(2-hydroxy-4-oxo-4H-chromen-3-yl)-1-phenylbutan-2-yl]oxy}sulfonic acid details
2-hydroxy-3-[(1R)-2-hydroxy-1-(3-hydroxyphenyl)-3-oxobutyl]-4H-chromen-4-one → {[1-(2-hydroxy-4-oxo-4H-chromen-3-yl)-1-(3-hydroxyphenyl)-3-oxobutan-2-yl]oxy}sulfonic acid details
2,8-dihydroxy-3-[(1R)-4-hydroxy-3-oxo-1-phenylbutyl]-4H-chromen-4-one → [4-(2,8-dihydroxy-4-oxo-4H-chromen-3-yl)-2-oxo-4-phenylbutoxy]sulfonic acid details
2,8-dihydroxy-3-[(1R)-3-hydroxy-1-phenylbutyl]-4H-chromen-4-one → {[4-(2,8-dihydroxy-4-oxo-4H-chromen-3-yl)-4-phenylbutan-2-yl]oxy}sulfonic acid details
4-[(3E)-5-hydroxy-4-(4-hydroxyphenyl)hex-3-en-3-yl]phenol → {[(3E)-3,4-bis(4-hydroxyphenyl)hex-3-en-2-yl]oxy}sulfonic acid details
4-[5-hydroxy-4-(4-hydroxyphenyl)hex-3-en-3-yl]phenol → {[3,4-bis(4-hydroxyphenyl)hex-3-en-2-yl]oxy}sulfonic acid details
4-[(3Z)-6-hydroxy-4-(4-hydroxyphenyl)hex-3-en-3-yl]phenol → {[(3Z)-3,4-bis(4-hydroxyphenyl)hex-3-en-1-yl]oxy}sulfonic acid details
2,2,2-trifluoro-N-(3-hydroxy-2-methyl-6-{[(3S)-3,5,12-trihydroxy-3-(2-hydroxyacetyl)-10-methoxy-6,11-dioxo-1,2,3,4,6,11-hexahydrotetracen-1-yl]oxy}oxan-4-yl)ethanimidic acid → 2,2,2-trifluoro-N-(3-hydroxy-2-methyl-6-{[(3S)-3,5,12-trihydroxy-10-methoxy-6,11-dioxo-3-[2-(sulfooxy)acetyl]-1,2,3,4,6,11-hexahydrotetracen-1-yl]oxy}oxan-4-yl)ethanimidic acid details
2,2,2-trifluoro-N-(3-hydroxy-2-methyl-6-{[(3S)-3,5,12-trihydroxy-3-(2-hydroxyacetyl)-10-methoxy-6,11-dioxo-1,2,3,4,6,11-hexahydrotetracen-1-yl]oxy}oxan-4-yl)ethanimidic acid → 2,2,2-trifluoro-N-[2-methyl-3-(sulfooxy)-6-{[(3S)-3,5,12-trihydroxy-3-(2-hydroxyacetyl)-10-methoxy-6,11-dioxo-1,2,3,4,6,11-hexahydrotetracen-1-yl]oxy}oxan-4-yl]ethanimidic acid details
2,2,2-trifluoro-N-[3-hydroxy-2-(hydroxymethyl)-6-{[(3S)-3,5,12-trihydroxy-10-methoxy-6,11-dioxo-3-[2-(pentanoyloxy)acetyl]-1,2,3,4,6,11-hexahydrotetracen-1-yl]oxy}oxan-4-yl]ethanimidic acid → 2,2,2-trifluoro-N-{3-hydroxy-2-[(sulfooxy)methyl]-6-{[(3S)-3,5,12-trihydroxy-10-methoxy-6,11-dioxo-3-[2-(pentanoyloxy)acetyl]-1,2,3,4,6,11-hexahydrotetracen-1-yl]oxy}oxan-4-yl}ethanimidic acid details
2,2,2-trifluoro-N-[3-hydroxy-2-(hydroxymethyl)-6-{[(3S)-3,5,12-trihydroxy-10-methoxy-6,11-dioxo-3-[2-(pentanoyloxy)acetyl]-1,2,3,4,6,11-hexahydrotetracen-1-yl]oxy}oxan-4-yl]ethanimidic acid → 2,2,2-trifluoro-N-[2-(hydroxymethyl)-3-(sulfooxy)-6-{[(3S)-3,5,12-trihydroxy-10-methoxy-6,11-dioxo-3-[2-(pentanoyloxy)acetyl]-1,2,3,4,6,11-hexahydrotetracen-1-yl]oxy}oxan-4-yl]ethanimidic acid details
2,2,2-trifluoro-N-(3-hydroxy-2-methyl-6-{[(3S)-3,5,8,12-tetrahydroxy-10-methoxy-6,11-dioxo-3-[2-(pentanoyloxy)acetyl]-1,2,3,4,6,11-hexahydrotetracen-1-yl]oxy}oxan-4-yl)ethanimidic acid → 2,2,2-trifluoro-N-[2-methyl-3-(sulfooxy)-6-{[(3S)-3,5,8,12-tetrahydroxy-10-methoxy-6,11-dioxo-3-[2-(pentanoyloxy)acetyl]-1,2,3,4,6,11-hexahydrotetracen-1-yl]oxy}oxan-4-yl]ethanimidic acid details
2,2,2-trifluoro-N-(3-hydroxy-2-methyl-6-{[(3S)-3,5,9,12-tetrahydroxy-10-methoxy-6,11-dioxo-3-[2-(pentanoyloxy)acetyl]-1,2,3,4,6,11-hexahydrotetracen-1-yl]oxy}oxan-4-yl)ethanimidic acid → 2,2,2-trifluoro-N-[2-methyl-3-(sulfooxy)-6-{[(3S)-3,5,9,12-tetrahydroxy-10-methoxy-6,11-dioxo-3-[2-(pentanoyloxy)acetyl]-1,2,3,4,6,11-hexahydrotetracen-1-yl]oxy}oxan-4-yl]ethanimidic acid details
2,2,2-trifluoro-N-(3-hydroxy-2-methyl-6-{[(3R)-3,4,5,12-tetrahydroxy-10-methoxy-6,11-dioxo-3-[2-(pentanoyloxy)acetyl]-1,2,3,4,6,11-hexahydrotetracen-1-yl]oxy}oxan-4-yl)ethanimidic acid → 2,2,2-trifluoro-N-(3-hydroxy-2-methyl-6-{[(3R)-3,5,12-trihydroxy-10-methoxy-6,11-dioxo-3-[2-(pentanoyloxy)acetyl]-4-(sulfooxy)-1,2,3,4,6,11-hexahydrotetracen-1-yl]oxy}oxan-4-yl)ethanimidic acid details
2,2,2-trifluoro-N-(3-hydroxy-2-methyl-6-{[(3R)-3,4,5,12-tetrahydroxy-10-methoxy-6,11-dioxo-3-[2-(pentanoyloxy)acetyl]-1,2,3,4,6,11-hexahydrotetracen-1-yl]oxy}oxan-4-yl)ethanimidic acid → 2,2,2-trifluoro-N-[2-methyl-3-(sulfooxy)-6-{[(3R)-3,4,5,12-tetrahydroxy-10-methoxy-6,11-dioxo-3-[2-(pentanoyloxy)acetyl]-1,2,3,4,6,11-hexahydrotetracen-1-yl]oxy}oxan-4-yl]ethanimidic acid details
2,2,2-trifluoro-N-(3-hydroxy-2-methyl-6-{[(3S)-3,5,12-trihydroxy-3-{2-[(4-hydroxypentanoyl)oxy]acetyl}-10-methoxy-6,11-dioxo-1,2,3,4,6,11-hexahydrotetracen-1-yl]oxy}oxan-4-yl)ethanimidic acid → 2,2,2-trifluoro-N-(3-hydroxy-2-methyl-6-{[(3S)-3,5,12-trihydroxy-10-methoxy-6,11-dioxo-3-(2-{[4-(sulfooxy)pentanoyl]oxy}acetyl)-1,2,3,4,6,11-hexahydrotetracen-1-yl]oxy}oxan-4-yl)ethanimidic acid details
2,2,2-trifluoro-N-(3-hydroxy-2-methyl-6-{[(3S)-3,5,12-trihydroxy-3-{2-[(4-hydroxypentanoyl)oxy]acetyl}-10-methoxy-6,11-dioxo-1,2,3,4,6,11-hexahydrotetracen-1-yl]oxy}oxan-4-yl)ethanimidic acid → 2,2,2-trifluoro-N-[2-methyl-3-(sulfooxy)-6-{[(3S)-3,5,12-trihydroxy-3-{2-[(4-hydroxypentanoyl)oxy]acetyl}-10-methoxy-6,11-dioxo-1,2,3,4,6,11-hexahydrotetracen-1-yl]oxy}oxan-4-yl]ethanimidic acid details
2,2,2-trifluoro-N-(3-hydroxy-2-methyl-6-{[(3S)-3,5,12-trihydroxy-3-{2-[(5-hydroxypentanoyl)oxy]acetyl}-10-methoxy-6,11-dioxo-1,2,3,4,6,11-hexahydrotetracen-1-yl]oxy}oxan-4-yl)ethanimidic acid → 2,2,2-trifluoro-N-(3-hydroxy-2-methyl-6-{[(3S)-3,5,12-trihydroxy-10-methoxy-6,11-dioxo-3-(2-{[5-(sulfooxy)pentanoyl]oxy}acetyl)-1,2,3,4,6,11-hexahydrotetracen-1-yl]oxy}oxan-4-yl)ethanimidic acid details
2,2,2-trifluoro-N-(3-hydroxy-2-methyl-6-{[(3S)-3,5,12-trihydroxy-3-{2-[(5-hydroxypentanoyl)oxy]acetyl}-10-methoxy-6,11-dioxo-1,2,3,4,6,11-hexahydrotetracen-1-yl]oxy}oxan-4-yl)ethanimidic acid → 2,2,2-trifluoro-N-[2-methyl-3-(sulfooxy)-6-{[(3S)-3,5,12-trihydroxy-3-{2-[(5-hydroxypentanoyl)oxy]acetyl}-10-methoxy-6,11-dioxo-1,2,3,4,6,11-hexahydrotetracen-1-yl]oxy}oxan-4-yl]ethanimidic acid details
2,2,2-trifluoro-N-(3-hydroxy-2-methyl-6-{[(3S)-3,5,12-trihydroxy-3-{2-[(2-hydroxypentanoyl)oxy]acetyl}-10-methoxy-6,11-dioxo-1,2,3,4,6,11-hexahydrotetracen-1-yl]oxy}oxan-4-yl)ethanimidic acid → 2,2,2-trifluoro-N-(3-hydroxy-2-methyl-6-{[(3S)-3,5,12-trihydroxy-10-methoxy-6,11-dioxo-3-(2-{[2-(sulfooxy)pentanoyl]oxy}acetyl)-1,2,3,4,6,11-hexahydrotetracen-1-yl]oxy}oxan-4-yl)ethanimidic acid details
2,2,2-trifluoro-N-(3-hydroxy-2-methyl-6-{[(3S)-3,5,12-trihydroxy-3-{2-[(2-hydroxypentanoyl)oxy]acetyl}-10-methoxy-6,11-dioxo-1,2,3,4,6,11-hexahydrotetracen-1-yl]oxy}oxan-4-yl)ethanimidic acid → 2,2,2-trifluoro-N-[2-methyl-3-(sulfooxy)-6-{[(3S)-3,5,12-trihydroxy-3-{2-[(2-hydroxypentanoyl)oxy]acetyl}-10-methoxy-6,11-dioxo-1,2,3,4,6,11-hexahydrotetracen-1-yl]oxy}oxan-4-yl]ethanimidic acid details
2,2,2-trifluoro-N-(3-hydroxy-2-methyl-6-{[(3S)-3,5,10,12-tetrahydroxy-6,11-dioxo-3-[2-(pentanoyloxy)acetyl]-1,2,3,4,6,11-hexahydrotetracen-1-yl]oxy}oxan-4-yl)ethanimidic acid → 2,2,2-trifluoro-N-[2-methyl-3-(sulfooxy)-6-{[(3S)-3,5,10,12-tetrahydroxy-6,11-dioxo-3-[2-(pentanoyloxy)acetyl]-1,2,3,4,6,11-hexahydrotetracen-1-yl]oxy}oxan-4-yl]ethanimidic acid details
2,2,2-trifluoro-N-(3-hydroxy-2-methylidene-6-{[(3S)-3,5,12-trihydroxy-10-methoxy-6,11-dioxo-3-[2-(pentanoyloxy)acetyl]-1,2,3,4,6,11-hexahydrotetracen-1-yl]oxy}oxan-4-yl)ethanimidic acid → 2,2,2-trifluoro-N-[2-methylidene-3-(sulfooxy)-6-{[(3S)-3,5,12-trihydroxy-10-methoxy-6,11-dioxo-3-[2-(pentanoyloxy)acetyl]-1,2,3,4,6,11-hexahydrotetracen-1-yl]oxy}oxan-4-yl]ethanimidic acid details
2,2,2-trifluoro-N-(3-hydroxy-2-methyl-6-{[(3S)-3,5,12-trihydroxy-10-methoxy-6,11-dioxo-3-[2-(pent-4-enoyloxy)acetyl]-1,2,3,4,6,11-hexahydrotetracen-1-yl]oxy}oxan-4-yl)ethanimidic acid → 2,2,2-trifluoro-N-[2-methyl-3-(sulfooxy)-6-{[(3S)-3,5,12-trihydroxy-10-methoxy-6,11-dioxo-3-[2-(pent-4-enoyloxy)acetyl]-1,2,3,4,6,11-hexahydrotetracen-1-yl]oxy}oxan-4-yl]ethanimidic acid details
4-Hydroxyvaleric acid → 4-(sulfooxy)pentanoic acid details
5-Hydroxypentanoic acid → 5-(sulfooxy)pentanoic acid details
2-Hydroxyvaleric acid → 2-(sulfooxy)pentanoic acid details
2,2,2-trifluoro-N-[3-hydroxy-2-(hydroxymethyl)-6-{[(3S)-3,5,12-trihydroxy-3-(2-hydroxyacetyl)-10-methoxy-6,11-dioxo-1,2,3,4,6,11-hexahydrotetracen-1-yl]oxy}oxan-4-yl]ethanimidic acid → 2,2,2-trifluoro-N-{3-hydroxy-2-[(sulfooxy)methyl]-6-{[(3S)-3,5,12-trihydroxy-3-(2-hydroxyacetyl)-10-methoxy-6,11-dioxo-1,2,3,4,6,11-hexahydrotetracen-1-yl]oxy}oxan-4-yl}ethanimidic acid details
2,2,2-trifluoro-N-[3-hydroxy-2-(hydroxymethyl)-6-{[(3S)-3,5,12-trihydroxy-3-(2-hydroxyacetyl)-10-methoxy-6,11-dioxo-1,2,3,4,6,11-hexahydrotetracen-1-yl]oxy}oxan-4-yl]ethanimidic acid → 2,2,2-trifluoro-N-[3-hydroxy-2-(hydroxymethyl)-6-{[(3S)-3,5,12-trihydroxy-10-methoxy-6,11-dioxo-3-[2-(sulfooxy)acetyl]-1,2,3,4,6,11-hexahydrotetracen-1-yl]oxy}oxan-4-yl]ethanimidic acid details
2,2,2-trifluoro-N-[3-hydroxy-2-(hydroxymethyl)-6-{[(3S)-3,5,12-trihydroxy-3-(2-hydroxyacetyl)-10-methoxy-6,11-dioxo-1,2,3,4,6,11-hexahydrotetracen-1-yl]oxy}oxan-4-yl]ethanimidic acid → 2,2,2-trifluoro-N-[2-(hydroxymethyl)-3-(sulfooxy)-6-{[(3S)-3,5,12-trihydroxy-3-(2-hydroxyacetyl)-10-methoxy-6,11-dioxo-1,2,3,4,6,11-hexahydrotetracen-1-yl]oxy}oxan-4-yl]ethanimidic acid details
2,2,2-trifluoro-N-(3-hydroxy-2-methyl-6-{[(3S)-3,5,8,12-tetrahydroxy-3-(2-hydroxyacetyl)-10-methoxy-6,11-dioxo-1,2,3,4,6,11-hexahydrotetracen-1-yl]oxy}oxan-4-yl)ethanimidic acid → 2,2,2-trifluoro-N-(3-hydroxy-2-methyl-6-{[(3S)-3,5,8,12-tetrahydroxy-10-methoxy-6,11-dioxo-3-[2-(sulfooxy)acetyl]-1,2,3,4,6,11-hexahydrotetracen-1-yl]oxy}oxan-4-yl)ethanimidic acid details
2,2,2-trifluoro-N-(3-hydroxy-2-methyl-6-{[(3S)-3,5,8,12-tetrahydroxy-3-(2-hydroxyacetyl)-10-methoxy-6,11-dioxo-1,2,3,4,6,11-hexahydrotetracen-1-yl]oxy}oxan-4-yl)ethanimidic acid → 2,2,2-trifluoro-N-[2-methyl-3-(sulfooxy)-6-{[(3S)-3,5,8,12-tetrahydroxy-3-(2-hydroxyacetyl)-10-methoxy-6,11-dioxo-1,2,3,4,6,11-hexahydrotetracen-1-yl]oxy}oxan-4-yl]ethanimidic acid details
2,2,2-trifluoro-N-(3-hydroxy-2-methyl-6-{[(3S)-3,5,9,12-tetrahydroxy-3-(2-hydroxyacetyl)-10-methoxy-6,11-dioxo-1,2,3,4,6,11-hexahydrotetracen-1-yl]oxy}oxan-4-yl)ethanimidic acid → 2,2,2-trifluoro-N-(3-hydroxy-2-methyl-6-{[(3S)-3,5,9,12-tetrahydroxy-10-methoxy-6,11-dioxo-3-[2-(sulfooxy)acetyl]-1,2,3,4,6,11-hexahydrotetracen-1-yl]oxy}oxan-4-yl)ethanimidic acid details
2,2,2-trifluoro-N-(3-hydroxy-2-methyl-6-{[(3S)-3,5,9,12-tetrahydroxy-3-(2-hydroxyacetyl)-10-methoxy-6,11-dioxo-1,2,3,4,6,11-hexahydrotetracen-1-yl]oxy}oxan-4-yl)ethanimidic acid → 2,2,2-trifluoro-N-[2-methyl-3-(sulfooxy)-6-{[(3S)-3,5,9,12-tetrahydroxy-3-(2-hydroxyacetyl)-10-methoxy-6,11-dioxo-1,2,3,4,6,11-hexahydrotetracen-1-yl]oxy}oxan-4-yl]ethanimidic acid details
2,2,2-trifluoro-N-(3-hydroxy-2-methyl-6-{[(3R)-3,4,5,12-tetrahydroxy-3-(2-hydroxyacetyl)-10-methoxy-6,11-dioxo-1,2,3,4,6,11-hexahydrotetracen-1-yl]oxy}oxan-4-yl)ethanimidic acid → 2,2,2-trifluoro-N-(3-hydroxy-2-methyl-6-{[(3R)-3,4,5,12-tetrahydroxy-10-methoxy-6,11-dioxo-3-[2-(sulfooxy)acetyl]-1,2,3,4,6,11-hexahydrotetracen-1-yl]oxy}oxan-4-yl)ethanimidic acid details
2,2,2-trifluoro-N-(3-hydroxy-2-methyl-6-{[(3R)-3,4,5,12-tetrahydroxy-3-(2-hydroxyacetyl)-10-methoxy-6,11-dioxo-1,2,3,4,6,11-hexahydrotetracen-1-yl]oxy}oxan-4-yl)ethanimidic acid → 2,2,2-trifluoro-N-(3-hydroxy-2-methyl-6-{[(3R)-3,5,12-trihydroxy-3-(2-hydroxyacetyl)-10-methoxy-6,11-dioxo-4-(sulfooxy)-1,2,3,4,6,11-hexahydrotetracen-1-yl]oxy}oxan-4-yl)ethanimidic acid details
2,2,2-trifluoro-N-(3-hydroxy-2-methyl-6-{[(3R)-3,4,5,12-tetrahydroxy-3-(2-hydroxyacetyl)-10-methoxy-6,11-dioxo-1,2,3,4,6,11-hexahydrotetracen-1-yl]oxy}oxan-4-yl)ethanimidic acid → 2,2,2-trifluoro-N-[2-methyl-3-(sulfooxy)-6-{[(3R)-3,4,5,12-tetrahydroxy-3-(2-hydroxyacetyl)-10-methoxy-6,11-dioxo-1,2,3,4,6,11-hexahydrotetracen-1-yl]oxy}oxan-4-yl]ethanimidic acid details
2,2,2-trifluoro-N-(3-hydroxy-2-methyl-6-{[(3S)-3,5,10,12-tetrahydroxy-3-(2-hydroxyacetyl)-6,11-dioxo-1,2,3,4,6,11-hexahydrotetracen-1-yl]oxy}oxan-4-yl)ethanimidic acid → 2,2,2-trifluoro-N-(3-hydroxy-2-methyl-6-{[(3S)-3,5,10,12-tetrahydroxy-6,11-dioxo-3-[2-(sulfooxy)acetyl]-1,2,3,4,6,11-hexahydrotetracen-1-yl]oxy}oxan-4-yl)ethanimidic acid details
2,2,2-trifluoro-N-(3-hydroxy-2-methyl-6-{[(3S)-3,5,10,12-tetrahydroxy-3-(2-hydroxyacetyl)-6,11-dioxo-1,2,3,4,6,11-hexahydrotetracen-1-yl]oxy}oxan-4-yl)ethanimidic acid → 2,2,2-trifluoro-N-[2-methyl-3-(sulfooxy)-6-{[(3S)-3,5,10,12-tetrahydroxy-3-(2-hydroxyacetyl)-6,11-dioxo-1,2,3,4,6,11-hexahydrotetracen-1-yl]oxy}oxan-4-yl]ethanimidic acid details
2,2,2-trifluoro-N-(3-hydroxy-2-methyl-6-{[(3S)-3,5,12-trihydroxy-10-methoxy-6,11-dioxo-3-(2-oxoacetyl)-1,2,3,4,6,11-hexahydrotetracen-1-yl]oxy}oxan-4-yl)ethanimidic acid → 2,2,2-trifluoro-N-[2-methyl-3-(sulfooxy)-6-{[(3S)-3,5,12-trihydroxy-10-methoxy-6,11-dioxo-3-(2-oxoacetyl)-1,2,3,4,6,11-hexahydrotetracen-1-yl]oxy}oxan-4-yl]ethanimidic acid details
2,2,2-trifluoro-N-(3-hydroxy-2-methylidene-6-{[(3S)-3,5,12-trihydroxy-3-(2-hydroxyacetyl)-10-methoxy-6,11-dioxo-1,2,3,4,6,11-hexahydrotetracen-1-yl]oxy}oxan-4-yl)ethanimidic acid → 2,2,2-trifluoro-N-(3-hydroxy-2-methylidene-6-{[(3S)-3,5,12-trihydroxy-10-methoxy-6,11-dioxo-3-[2-(sulfooxy)acetyl]-1,2,3,4,6,11-hexahydrotetracen-1-yl]oxy}oxan-4-yl)ethanimidic acid details
2,2,2-trifluoro-N-(3-hydroxy-2-methylidene-6-{[(3S)-3,5,12-trihydroxy-3-(2-hydroxyacetyl)-10-methoxy-6,11-dioxo-1,2,3,4,6,11-hexahydrotetracen-1-yl]oxy}oxan-4-yl)ethanimidic acid → 2,2,2-trifluoro-N-[2-methylidene-3-(sulfooxy)-6-{[(3S)-3,5,12-trihydroxy-3-(2-hydroxyacetyl)-10-methoxy-6,11-dioxo-1,2,3,4,6,11-hexahydrotetracen-1-yl]oxy}oxan-4-yl]ethanimidic acid details
(8S)-10-{[4-amino-5-hydroxy-6-(hydroxymethyl)oxan-2-yl]oxy}-6,8,11-trihydroxy-8-(2-hydroxyacetyl)-1-methoxy-5,7,8,9,10,12-hexahydrotetracene-5,12-dione → [(4-amino-3-hydroxy-6-{[(3S)-3,5,12-trihydroxy-3-(2-hydroxyacetyl)-10-methoxy-6,11-dioxo-1,2,3,4,6,11-hexahydrotetracen-1-yl]oxy}oxan-2-yl)methoxy]sulfonic acid details
(8S)-10-{[4-amino-5-hydroxy-6-(hydroxymethyl)oxan-2-yl]oxy}-6,8,11-trihydroxy-8-(2-hydroxyacetyl)-1-methoxy-5,7,8,9,10,12-hexahydrotetracene-5,12-dione → {2-[(2S)-4-{[4-amino-5-hydroxy-6-(hydroxymethyl)oxan-2-yl]oxy}-2,5,12-trihydroxy-7-methoxy-6,11-dioxo-1,2,3,4,6,11-hexahydrotetracen-2-yl]-2-oxoethoxy}sulfonic acid details
(8S)-10-{[4-amino-5-hydroxy-6-(hydroxymethyl)oxan-2-yl]oxy}-6,8,11-trihydroxy-8-(2-hydroxyacetyl)-1-methoxy-5,7,8,9,10,12-hexahydrotetracene-5,12-dione → [4-amino-2-(hydroxymethyl)-6-{[(3S)-3,5,12-trihydroxy-3-(2-hydroxyacetyl)-10-methoxy-6,11-dioxo-1,2,3,4,6,11-hexahydrotetracen-1-yl]oxy}oxan-3-yl]oxidanesulfonic acid details
(8S)-10-[(4-amino-5-hydroxy-6-methyloxan-2-yl)oxy]-3,6,8,11-tetrahydroxy-8-(2-hydroxyacetyl)-1-methoxy-5,7,8,9,10,12-hexahydrotetracene-5,12-dione → {2-[(2S)-4-[(4-amino-5-hydroxy-6-methyloxan-2-yl)oxy]-2,5,9,12-tetrahydroxy-7-methoxy-6,11-dioxo-1,2,3,4,6,11-hexahydrotetracen-2-yl]-2-oxoethoxy}sulfonic acid details
(8S)-10-[(4-amino-5-hydroxy-6-methyloxan-2-yl)oxy]-3,6,8,11-tetrahydroxy-8-(2-hydroxyacetyl)-1-methoxy-5,7,8,9,10,12-hexahydrotetracene-5,12-dione → (4-amino-2-methyl-6-{[(3S)-3,5,8,12-tetrahydroxy-3-(2-hydroxyacetyl)-10-methoxy-6,11-dioxo-1,2,3,4,6,11-hexahydrotetracen-1-yl]oxy}oxan-3-yl)oxidanesulfonic acid details
(8S)-10-[(4-amino-5-hydroxy-6-methyloxan-2-yl)oxy]-2,6,8,11-tetrahydroxy-8-(2-hydroxyacetyl)-1-methoxy-5,7,8,9,10,12-hexahydrotetracene-5,12-dione → {2-[(2S)-4-[(4-amino-5-hydroxy-6-methyloxan-2-yl)oxy]-2,5,8,12-tetrahydroxy-7-methoxy-6,11-dioxo-1,2,3,4,6,11-hexahydrotetracen-2-yl]-2-oxoethoxy}sulfonic acid details
(8S)-10-[(4-amino-5-hydroxy-6-methyloxan-2-yl)oxy]-2,6,8,11-tetrahydroxy-8-(2-hydroxyacetyl)-1-methoxy-5,7,8,9,10,12-hexahydrotetracene-5,12-dione → (4-amino-2-methyl-6-{[(3S)-3,5,9,12-tetrahydroxy-3-(2-hydroxyacetyl)-10-methoxy-6,11-dioxo-1,2,3,4,6,11-hexahydrotetracen-1-yl]oxy}oxan-3-yl)oxidanesulfonic acid details
(8R)-10-[(4-amino-5-hydroxy-6-methyloxan-2-yl)oxy]-6,7,8,11-tetrahydroxy-8-(2-hydroxyacetyl)-1-methoxy-5,7,8,9,10,12-hexahydrotetracene-5,12-dione → {2-[(2R)-4-[(4-amino-5-hydroxy-6-methyloxan-2-yl)oxy]-1,2,5,12-tetrahydroxy-7-methoxy-6,11-dioxo-1,2,3,4,6,11-hexahydrotetracen-2-yl]-2-oxoethoxy}sulfonic acid details
(8R)-10-[(4-amino-5-hydroxy-6-methyloxan-2-yl)oxy]-6,7,8,11-tetrahydroxy-8-(2-hydroxyacetyl)-1-methoxy-5,7,8,9,10,12-hexahydrotetracene-5,12-dione → [(2R)-4-[(4-amino-5-hydroxy-6-methyloxan-2-yl)oxy]-2,5,12-trihydroxy-2-(2-hydroxyacetyl)-7-methoxy-6,11-dioxo-1,2,3,4,6,11-hexahydrotetracen-1-yl]oxidanesulfonic acid details
(8R)-10-[(4-amino-5-hydroxy-6-methyloxan-2-yl)oxy]-6,7,8,11-tetrahydroxy-8-(2-hydroxyacetyl)-1-methoxy-5,7,8,9,10,12-hexahydrotetracene-5,12-dione → (4-amino-2-methyl-6-{[(3R)-3,4,5,12-tetrahydroxy-3-(2-hydroxyacetyl)-10-methoxy-6,11-dioxo-1,2,3,4,6,11-hexahydrotetracen-1-yl]oxy}oxan-3-yl)oxidanesulfonic acid details
(8S)-10-[(4-amino-5-hydroxy-6-methyloxan-2-yl)oxy]-1,6,8,11-tetrahydroxy-8-(2-hydroxyacetyl)-5,7,8,9,10,12-hexahydrotetracene-5,12-dione → {2-[(2S)-4-[(4-amino-5-hydroxy-6-methyloxan-2-yl)oxy]-2,5,7,12-tetrahydroxy-6,11-dioxo-1,2,3,4,6,11-hexahydrotetracen-2-yl]-2-oxoethoxy}sulfonic acid details
(8S)-10-[(4-amino-5-hydroxy-6-methyloxan-2-yl)oxy]-1,6,8,11-tetrahydroxy-8-(2-hydroxyacetyl)-5,7,8,9,10,12-hexahydrotetracene-5,12-dione → (4-amino-2-methyl-6-{[(3S)-3,5,10,12-tetrahydroxy-3-(2-hydroxyacetyl)-6,11-dioxo-1,2,3,4,6,11-hexahydrotetracen-1-yl]oxy}oxan-3-yl)oxidanesulfonic acid details
2-[(2S)-4-[(4-amino-5-hydroxy-6-methyloxan-2-yl)oxy]-2,5,12-trihydroxy-7-methoxy-6,11-dioxo-1,2,3,4,6,11-hexahydrotetracen-2-yl]-2-oxoacetaldehyde → (4-amino-2-methyl-6-{[(3S)-3,5,12-trihydroxy-10-methoxy-6,11-dioxo-3-(2-oxoacetyl)-1,2,3,4,6,11-hexahydrotetracen-1-yl]oxy}oxan-3-yl)oxidanesulfonic acid details
(8S)-10-[(4-amino-5-hydroxy-6-methylideneoxan-2-yl)oxy]-6,8,11-trihydroxy-8-(2-hydroxyacetyl)-1-methoxy-5,7,8,9,10,12-hexahydrotetracene-5,12-dione → {2-[(2S)-4-[(4-amino-5-hydroxy-6-methylideneoxan-2-yl)oxy]-2,5,12-trihydroxy-7-methoxy-6,11-dioxo-1,2,3,4,6,11-hexahydrotetracen-2-yl]-2-oxoethoxy}sulfonic acid details
(8S)-10-[(4-amino-5-hydroxy-6-methylideneoxan-2-yl)oxy]-6,8,11-trihydroxy-8-(2-hydroxyacetyl)-1-methoxy-5,7,8,9,10,12-hexahydrotetracene-5,12-dione → (4-amino-2-methylidene-6-{[(3S)-3,5,12-trihydroxy-3-(2-hydroxyacetyl)-10-methoxy-6,11-dioxo-1,2,3,4,6,11-hexahydrotetracen-1-yl]oxy}oxan-3-yl)oxidanesulfonic acid details
2-(1-{[(1-{3-[(E)-2-(7-chloroquinolin-2-yl)ethenyl]phenyl}-3-hydroxy-3-[2-(2-hydroxypropan-2-yl)phenyl]propyl)sulfanyl]methyl}cyclopropyl)acetic acid → 2-(1-{[(1-{3-[(E)-2-(7-chloroquinolin-2-yl)ethenyl]phenyl}-3-[2-(2-hydroxypropan-2-yl)phenyl]-3-(sulfooxy)propyl)sulfanyl]methyl}cyclopropyl)acetic acid details
2-(1-{[(1-{3-[(E)-2-(7-chloroquinolin-2-yl)ethenyl]phenyl}-3-[2-(1,2-dihydroxypropan-2-yl)phenyl]propyl)sulfanyl]methyl}cyclopropyl)acetic acid → 2-(1-{[(1-{3-[(E)-2-(7-chloroquinolin-2-yl)ethenyl]phenyl}-3-{2-[2-hydroxy-1-(sulfooxy)propan-2-yl]phenyl}propyl)sulfanyl]methyl}cyclopropyl)acetic acid details
2-(1-{[(1-{3-[(E)-2-(7-chloroquinolin-2-yl)ethenyl]phenyl}-3-[2-(2-hydroxypropan-2-yl)phenyl]propyl)sulfanyl]methyl}cyclopropyl)-2-hydroxyacetic acid → 2-(1-{[(1-{3-[(E)-2-(7-chloroquinolin-2-yl)ethenyl]phenyl}-3-[2-(2-hydroxypropan-2-yl)phenyl]propyl)sulfanyl]methyl}cyclopropyl)-2-(sulfooxy)acetic acid details
2-(1-{[(1-{3-[(E)-2-(7-chloroquinolin-2-yl)ethenyl]phenyl}-3-[2-(2-hydroxypropan-2-yl)phenyl]propyl)sulfanyl]methyl}-2-hydroxycyclopropyl)acetic acid → 2-(1-{[(1-{3-[(E)-2-(7-chloroquinolin-2-yl)ethenyl]phenyl}-3-[2-(2-hydroxypropan-2-yl)phenyl]propyl)sulfanyl]methyl}-2-(sulfooxy)cyclopropyl)acetic acid details
1-chloro-4-{4-[2-(dimethylamino)ethoxy]phenyl}-3,4-diphenylbut-3-en-2-ol → [(1-chloro-4-{4-[2-(dimethylamino)ethoxy]phenyl}-3,4-diphenylbut-3-en-2-yl)oxy]sulfonic acid details
Propyl alcohol → Propyl sulfate details
11-[(2R,3S)-3-[2-amino-3-methyl-4-(2-methyl-1,3-thiazol-4-yl)but-3-en-1-yl]-2-methyloxiran-2-yl]-3,7-dihydroxy-4,4,6,8-tetramethyl-5-oxoundecanoic acid → 11-[(2R)-3-[2-amino-3-methyl-4-(2-methyl-1,3-thiazol-4-yl)but-3-en-1-yl]-2-methyloxiran-2-yl]-3-hydroxy-4,4,6,8-tetramethyl-5-oxo-7-(sulfooxy)undecanoic acid details
11-[(2R,3S)-3-[2-amino-3-methyl-4-(2-methyl-1,3-thiazol-4-yl)but-3-en-1-yl]-2-methyloxiran-2-yl]-3,7-dihydroxy-4,4,6,8-tetramethyl-5-oxoundecanoic acid → 11-[(2R)-3-[2-amino-3-methyl-4-(2-methyl-1,3-thiazol-4-yl)but-3-en-1-yl]-2-methyloxiran-2-yl]-7-hydroxy-4,4,6,8-tetramethyl-5-oxo-3-(sulfooxy)undecanoic acid details
(1S,16R)-5,7,11-trihydroxy-3-[3-hydroxy-1-(2-methyl-1,3-thiazol-4-yl)prop-1-en-2-yl]-8,8,10,12,16-pentamethyl-17-oxa-4-azabicyclo[14.1.0]heptadec-4-en-9-one → {[3-(2-methyl-1,3-thiazol-4-yl)-2-[(16R)-5,7,11-trihydroxy-8,8,10,12,16-pentamethyl-9-oxo-17-oxa-4-azabicyclo[14.1.0]heptadec-4-en-3-yl]prop-2-en-1-yl]oxy}sulfonic acid details
(1S,16R)-5,7,11-trihydroxy-3-[3-hydroxy-1-(2-methyl-1,3-thiazol-4-yl)prop-1-en-2-yl]-8,8,10,12,16-pentamethyl-17-oxa-4-azabicyclo[14.1.0]heptadec-4-en-9-one → [(16R)-5,7-dihydroxy-3-[3-hydroxy-1-(2-methyl-1,3-thiazol-4-yl)prop-1-en-2-yl]-8,8,10,12,16-pentamethyl-9-oxo-17-oxa-4-azabicyclo[14.1.0]heptadec-4-en-11-yl]oxidanesulfonic acid details
(1S,16R)-5,7,11-trihydroxy-3-[3-hydroxy-1-(2-methyl-1,3-thiazol-4-yl)prop-1-en-2-yl]-8,8,10,12,16-pentamethyl-17-oxa-4-azabicyclo[14.1.0]heptadec-4-en-9-one → [(16R)-5,11-dihydroxy-3-[3-hydroxy-1-(2-methyl-1,3-thiazol-4-yl)prop-1-en-2-yl]-8,8,10,12,16-pentamethyl-9-oxo-17-oxa-4-azabicyclo[14.1.0]heptadec-4-en-7-yl]oxidanesulfonic acid details
(1S,16R)-5,7,10,11-tetrahydroxy-8,8,10,12,16-pentamethyl-3-[1-(2-methyl-1,3-thiazol-4-yl)prop-1-en-2-yl]-17-oxa-4-azabicyclo[14.1.0]heptadec-4-en-9-one → [(16R)-5,7,10-trihydroxy-8,8,10,12,16-pentamethyl-3-[1-(2-methyl-1,3-thiazol-4-yl)prop-1-en-2-yl]-9-oxo-17-oxa-4-azabicyclo[14.1.0]heptadec-4-en-11-yl]oxidanesulfonic acid details
(1S,16R)-5,7,10,11-tetrahydroxy-8,8,10,12,16-pentamethyl-3-[1-(2-methyl-1,3-thiazol-4-yl)prop-1-en-2-yl]-17-oxa-4-azabicyclo[14.1.0]heptadec-4-en-9-one → [(16R)-5,10,11-trihydroxy-8,8,10,12,16-pentamethyl-3-[1-(2-methyl-1,3-thiazol-4-yl)prop-1-en-2-yl]-9-oxo-17-oxa-4-azabicyclo[14.1.0]heptadec-4-en-7-yl]oxidanesulfonic acid details
(1S,16R)-5,7,11,12-tetrahydroxy-8,8,10,12,16-pentamethyl-3-[1-(2-methyl-1,3-thiazol-4-yl)prop-1-en-2-yl]-17-oxa-4-azabicyclo[14.1.0]heptadec-4-en-9-one → [(16R)-5,7,12-trihydroxy-8,8,10,12,16-pentamethyl-3-[1-(2-methyl-1,3-thiazol-4-yl)prop-1-en-2-yl]-9-oxo-17-oxa-4-azabicyclo[14.1.0]heptadec-4-en-11-yl]oxidanesulfonic acid details
(1S,16R)-5,7,11,12-tetrahydroxy-8,8,10,12,16-pentamethyl-3-[1-(2-methyl-1,3-thiazol-4-yl)prop-1-en-2-yl]-17-oxa-4-azabicyclo[14.1.0]heptadec-4-en-9-one → [(16R)-5,11,12-trihydroxy-8,8,10,12,16-pentamethyl-3-[1-(2-methyl-1,3-thiazol-4-yl)prop-1-en-2-yl]-9-oxo-17-oxa-4-azabicyclo[14.1.0]heptadec-4-en-7-yl]oxidanesulfonic acid details
(1S,16R)-5,7,11-trihydroxy-3-{1-[2-(hydroxymethyl)-1,3-thiazol-4-yl]prop-1-en-2-yl}-8,8,10,12,16-pentamethyl-17-oxa-4-azabicyclo[14.1.0]heptadec-4-en-9-one → [(4-{2-[(16R)-5,7,11-trihydroxy-8,8,10,12,16-pentamethyl-9-oxo-17-oxa-4-azabicyclo[14.1.0]heptadec-4-en-3-yl]prop-1-en-1-yl}-1,3-thiazol-2-yl)methoxy]sulfonic acid details
(1S,16R)-5,7,11-trihydroxy-3-{1-[2-(hydroxymethyl)-1,3-thiazol-4-yl]prop-1-en-2-yl}-8,8,10,12,16-pentamethyl-17-oxa-4-azabicyclo[14.1.0]heptadec-4-en-9-one → [(16R)-5,7-dihydroxy-3-{1-[2-(hydroxymethyl)-1,3-thiazol-4-yl]prop-1-en-2-yl}-8,8,10,12,16-pentamethyl-9-oxo-17-oxa-4-azabicyclo[14.1.0]heptadec-4-en-11-yl]oxidanesulfonic acid details
(1S,16R)-5,7,11-trihydroxy-3-{1-[2-(hydroxymethyl)-1,3-thiazol-4-yl]prop-1-en-2-yl}-8,8,10,12,16-pentamethyl-17-oxa-4-azabicyclo[14.1.0]heptadec-4-en-9-one → [(16R)-5,11-dihydroxy-3-{1-[2-(hydroxymethyl)-1,3-thiazol-4-yl]prop-1-en-2-yl}-8,8,10,12,16-pentamethyl-9-oxo-17-oxa-4-azabicyclo[14.1.0]heptadec-4-en-7-yl]oxidanesulfonic acid details
(1S,16R)-5,7,11-trihydroxy-10-(hydroxymethyl)-8,8,12,16-tetramethyl-3-[1-(2-methyl-1,3-thiazol-4-yl)prop-1-en-2-yl]-17-oxa-4-azabicyclo[14.1.0]heptadec-4-en-9-one → {[(16R)-5,7,11-trihydroxy-8,8,12,16-tetramethyl-3-[1-(2-methyl-1,3-thiazol-4-yl)prop-1-en-2-yl]-9-oxo-17-oxa-4-azabicyclo[14.1.0]heptadec-4-en-10-yl]methoxy}sulfonic acid details
(1S,16R)-5,7,11-trihydroxy-10-(hydroxymethyl)-8,8,12,16-tetramethyl-3-[1-(2-methyl-1,3-thiazol-4-yl)prop-1-en-2-yl]-17-oxa-4-azabicyclo[14.1.0]heptadec-4-en-9-one → [(16R)-5,7-dihydroxy-10-(hydroxymethyl)-8,8,12,16-tetramethyl-3-[1-(2-methyl-1,3-thiazol-4-yl)prop-1-en-2-yl]-9-oxo-17-oxa-4-azabicyclo[14.1.0]heptadec-4-en-11-yl]oxidanesulfonic acid details
(1S,16R)-5,7,11-trihydroxy-10-(hydroxymethyl)-8,8,12,16-tetramethyl-3-[1-(2-methyl-1,3-thiazol-4-yl)prop-1-en-2-yl]-17-oxa-4-azabicyclo[14.1.0]heptadec-4-en-9-one → [(16R)-5,11-dihydroxy-10-(hydroxymethyl)-8,8,12,16-tetramethyl-3-[1-(2-methyl-1,3-thiazol-4-yl)prop-1-en-2-yl]-9-oxo-17-oxa-4-azabicyclo[14.1.0]heptadec-4-en-7-yl]oxidanesulfonic acid details
(1S,16R)-5,7,11-trihydroxy-8-(hydroxymethyl)-8,10,12,16-tetramethyl-3-[1-(2-methyl-1,3-thiazol-4-yl)prop-1-en-2-yl]-17-oxa-4-azabicyclo[14.1.0]heptadec-4-en-9-one → {[(16R)-5,7,11-trihydroxy-8,10,12,16-tetramethyl-3-[1-(2-methyl-1,3-thiazol-4-yl)prop-1-en-2-yl]-9-oxo-17-oxa-4-azabicyclo[14.1.0]heptadec-4-en-8-yl]methoxy}sulfonic acid details
(1S,16R)-5,7,11-trihydroxy-8-(hydroxymethyl)-8,10,12,16-tetramethyl-3-[1-(2-methyl-1,3-thiazol-4-yl)prop-1-en-2-yl]-17-oxa-4-azabicyclo[14.1.0]heptadec-4-en-9-one → [(16R)-5,7-dihydroxy-8-(hydroxymethyl)-8,10,12,16-tetramethyl-3-[1-(2-methyl-1,3-thiazol-4-yl)prop-1-en-2-yl]-9-oxo-17-oxa-4-azabicyclo[14.1.0]heptadec-4-en-11-yl]oxidanesulfonic acid details
(1S,16R)-5,7,11-trihydroxy-8-(hydroxymethyl)-8,10,12,16-tetramethyl-3-[1-(2-methyl-1,3-thiazol-4-yl)prop-1-en-2-yl]-17-oxa-4-azabicyclo[14.1.0]heptadec-4-en-9-one → [(16R)-5,11-dihydroxy-8-(hydroxymethyl)-8,10,12,16-tetramethyl-3-[1-(2-methyl-1,3-thiazol-4-yl)prop-1-en-2-yl]-9-oxo-17-oxa-4-azabicyclo[14.1.0]heptadec-4-en-7-yl]oxidanesulfonic acid details
(1S,16S)-5,7,11-trihydroxy-16-(hydroxymethyl)-8,8,10,12-tetramethyl-3-[1-(2-methyl-1,3-thiazol-4-yl)prop-1-en-2-yl]-17-oxa-4-azabicyclo[14.1.0]heptadec-4-en-9-one → {[(16S)-5,7,11-trihydroxy-8,8,10,12-tetramethyl-3-[1-(2-methyl-1,3-thiazol-4-yl)prop-1-en-2-yl]-9-oxo-17-oxa-4-azabicyclo[14.1.0]heptadec-4-en-16-yl]methoxy}sulfonic acid details
(1S,16S)-5,7,11-trihydroxy-16-(hydroxymethyl)-8,8,10,12-tetramethyl-3-[1-(2-methyl-1,3-thiazol-4-yl)prop-1-en-2-yl]-17-oxa-4-azabicyclo[14.1.0]heptadec-4-en-9-one → [(16S)-5,7-dihydroxy-16-(hydroxymethyl)-8,8,10,12-tetramethyl-3-[1-(2-methyl-1,3-thiazol-4-yl)prop-1-en-2-yl]-9-oxo-17-oxa-4-azabicyclo[14.1.0]heptadec-4-en-11-yl]oxidanesulfonic acid details
(1S,16S)-5,7,11-trihydroxy-16-(hydroxymethyl)-8,8,10,12-tetramethyl-3-[1-(2-methyl-1,3-thiazol-4-yl)prop-1-en-2-yl]-17-oxa-4-azabicyclo[14.1.0]heptadec-4-en-9-one → [(16S)-5,11-dihydroxy-16-(hydroxymethyl)-8,8,10,12-tetramethyl-3-[1-(2-methyl-1,3-thiazol-4-yl)prop-1-en-2-yl]-9-oxo-17-oxa-4-azabicyclo[14.1.0]heptadec-4-en-7-yl]oxidanesulfonic acid details
(1S,16R)-5,7,11-trihydroxy-12-(hydroxymethyl)-8,8,10,16-tetramethyl-3-[1-(2-methyl-1,3-thiazol-4-yl)prop-1-en-2-yl]-17-oxa-4-azabicyclo[14.1.0]heptadec-4-en-9-one → {[(16R)-5,7,11-trihydroxy-8,8,10,16-tetramethyl-3-[1-(2-methyl-1,3-thiazol-4-yl)prop-1-en-2-yl]-9-oxo-17-oxa-4-azabicyclo[14.1.0]heptadec-4-en-12-yl]methoxy}sulfonic acid details
(1S,16R)-5,7,11-trihydroxy-12-(hydroxymethyl)-8,8,10,16-tetramethyl-3-[1-(2-methyl-1,3-thiazol-4-yl)prop-1-en-2-yl]-17-oxa-4-azabicyclo[14.1.0]heptadec-4-en-9-one → [(16R)-5,7-dihydroxy-12-(hydroxymethyl)-8,8,10,16-tetramethyl-3-[1-(2-methyl-1,3-thiazol-4-yl)prop-1-en-2-yl]-9-oxo-17-oxa-4-azabicyclo[14.1.0]heptadec-4-en-11-yl]oxidanesulfonic acid details
(1S,16R)-5,7,11-trihydroxy-12-(hydroxymethyl)-8,8,10,16-tetramethyl-3-[1-(2-methyl-1,3-thiazol-4-yl)prop-1-en-2-yl]-17-oxa-4-azabicyclo[14.1.0]heptadec-4-en-9-one → [(16R)-5,11-dihydroxy-12-(hydroxymethyl)-8,8,10,16-tetramethyl-3-[1-(2-methyl-1,3-thiazol-4-yl)prop-1-en-2-yl]-9-oxo-17-oxa-4-azabicyclo[14.1.0]heptadec-4-en-7-yl]oxidanesulfonic acid details
(1S,16R)-5,7,11-trihydroxy-8,8,12,16-tetramethyl-3-[1-(2-methyl-1,3-thiazol-4-yl)prop-1-en-2-yl]-10-methylidene-17-oxa-4-azabicyclo[14.1.0]heptadec-4-en-9-one → [(16R)-5,7-dihydroxy-8,8,12,16-tetramethyl-3-[1-(2-methyl-1,3-thiazol-4-yl)prop-1-en-2-yl]-10-methylidene-9-oxo-17-oxa-4-azabicyclo[14.1.0]heptadec-4-en-11-yl]oxidanesulfonic acid details
(1S,16R)-5,7,11-trihydroxy-8,8,12,16-tetramethyl-3-[1-(2-methyl-1,3-thiazol-4-yl)prop-1-en-2-yl]-10-methylidene-17-oxa-4-azabicyclo[14.1.0]heptadec-4-en-9-one → [(16R)-5,11-dihydroxy-8,8,12,16-tetramethyl-3-[1-(2-methyl-1,3-thiazol-4-yl)prop-1-en-2-yl]-10-methylidene-9-oxo-17-oxa-4-azabicyclo[14.1.0]heptadec-4-en-7-yl]oxidanesulfonic acid details
(1S,16R)-5,7,11-trihydroxy-8,8,10,16-tetramethyl-3-[1-(2-methyl-1,3-thiazol-4-yl)prop-1-en-2-yl]-12-methylidene-17-oxa-4-azabicyclo[14.1.0]heptadec-4-en-9-one → [(16R)-5,7-dihydroxy-8,8,10,16-tetramethyl-3-[1-(2-methyl-1,3-thiazol-4-yl)prop-1-en-2-yl]-12-methylidene-9-oxo-17-oxa-4-azabicyclo[14.1.0]heptadec-4-en-11-yl]oxidanesulfonic acid details
(1S,16R)-5,7,11-trihydroxy-8,8,10,16-tetramethyl-3-[1-(2-methyl-1,3-thiazol-4-yl)prop-1-en-2-yl]-12-methylidene-17-oxa-4-azabicyclo[14.1.0]heptadec-4-en-9-one → [(16R)-5,11-dihydroxy-8,8,10,16-tetramethyl-3-[1-(2-methyl-1,3-thiazol-4-yl)prop-1-en-2-yl]-12-methylidene-9-oxo-17-oxa-4-azabicyclo[14.1.0]heptadec-4-en-7-yl]oxidanesulfonic acid details
(1S,16R)-5,6,7,11-tetrahydroxy-8,8,10,12,16-pentamethyl-3-[1-(2-methyl-1,3-thiazol-4-yl)prop-1-en-2-yl]-17-oxa-4-azabicyclo[14.1.0]heptadec-4-en-9-one → [(16R)-5,7,11-trihydroxy-8,8,10,12,16-pentamethyl-3-[1-(2-methyl-1,3-thiazol-4-yl)prop-1-en-2-yl]-9-oxo-17-oxa-4-azabicyclo[14.1.0]heptadec-4-en-6-yl]oxidanesulfonic acid details
(1S,16R)-5,6,7,11-tetrahydroxy-8,8,10,12,16-pentamethyl-3-[1-(2-methyl-1,3-thiazol-4-yl)prop-1-en-2-yl]-17-oxa-4-azabicyclo[14.1.0]heptadec-4-en-9-one → [(16R)-5,6,7-trihydroxy-8,8,10,12,16-pentamethyl-3-[1-(2-methyl-1,3-thiazol-4-yl)prop-1-en-2-yl]-9-oxo-17-oxa-4-azabicyclo[14.1.0]heptadec-4-en-11-yl]oxidanesulfonic acid details
(1S,16R)-5,6,7,11-tetrahydroxy-8,8,10,12,16-pentamethyl-3-[1-(2-methyl-1,3-thiazol-4-yl)prop-1-en-2-yl]-17-oxa-4-azabicyclo[14.1.0]heptadec-4-en-9-one → [(16R)-5,6,11-trihydroxy-8,8,10,12,16-pentamethyl-3-[1-(2-methyl-1,3-thiazol-4-yl)prop-1-en-2-yl]-9-oxo-17-oxa-4-azabicyclo[14.1.0]heptadec-4-en-7-yl]oxidanesulfonic acid details
2-[2-hydroxy-3-(4-hydroxy-3-methoxyphenyl)propyl]benzene-1,3,5-triol → {[1-(4-hydroxy-3-methoxyphenyl)-3-(2,4,6-trihydroxyphenyl)propan-2-yl]oxy}sulfonic acid details
4-hydroxy-5-(4-hydroxy-3-methoxyphenyl)pentanoic acid → 5-(4-hydroxy-3-methoxyphenyl)-4-(sulfooxy)pentanoic acid details
2-[2-hydroxy-3-(3-methoxyphenyl)propyl]benzene-1,3,5-triol → {[1-(3-methoxyphenyl)-3-(2,4,6-trihydroxyphenyl)propan-2-yl]oxy}sulfonic acid details
4-hydroxy-5-(3-methoxyphenyl)pentanoic acid → 5-(3-methoxyphenyl)-4-(sulfooxy)pentanoic acid details
2-{[5,7-dihydroxy-2-(3-hydroxyphenyl)-5H-chromen-3-yl]oxy}oxane-3,4,5-triol → (2-{[5,7-dihydroxy-2-(3-hydroxyphenyl)-5H-chromen-3-yl]oxy}-3,5-dihydroxyoxan-4-yl)oxidanesulfonic acid details
2-{[5,7-dihydroxy-2-(3-hydroxyphenyl)-5H-chromen-3-yl]oxy}oxane-3,4,5-triol → (2-{[5,7-dihydroxy-2-(3-hydroxyphenyl)-5H-chromen-3-yl]oxy}-4,5-dihydroxyoxan-3-yl)oxidanesulfonic acid details
2-{[5,7-dihydroxy-2-(3-hydroxyphenyl)-5H-chromen-3-yl]oxy}oxane-3,4,5-triol → (6-{[5,7-dihydroxy-2-(3-hydroxyphenyl)-5H-chromen-3-yl]oxy}-4,5-dihydroxyoxan-3-yl)oxidanesulfonic acid details
3-hydroxy-2-methylpropanoic acid → 2-methyl-3-(sulfooxy)propanoic acid details
6,11-dihydroxy-3-(hydroxymethyl)-7-(3,4,5-trihydroxyphenyl)-2λ⁴,8-dioxatricyclo[7.3.1.0⁵,¹³]trideca-1,3,5(13),6,9,11-hexaen-2-ylium → {4-hydroxy-7-[(sulfooxy)methyl]-3-(3,4,5-trihydroxyphenyl)-2,8-dioxatricyclo[7.3.1.0⁵,¹³]trideca-1(12),3,5(13),6,9-pentaen-11-ylidene}oxidanium details
(S)-Naringenin 8-C-(2''-rhamnosylglucoside) → ({6-[5,7-dihydroxy-2-(4-hydroxyphenyl)-4-oxo-3,4-dihydro-2H-1-benzopyran-8-yl]-3,4-dihydroxy-5-[(3,4,5-trihydroxy-6-methyloxan-2-yl)oxy]oxan-2-yl}methoxy)sulfonic acid details
(S)-Naringenin 8-C-(2''-rhamnosylglucoside) → {6-[5,7-dihydroxy-2-(4-hydroxyphenyl)-4-oxo-3,4-dihydro-2H-1-benzopyran-8-yl]-4-hydroxy-2-(hydroxymethyl)-5-[(3,4,5-trihydroxy-6-methyloxan-2-yl)oxy]oxan-3-yl}oxidanesulfonic acid details
(S)-Naringenin 8-C-(2''-rhamnosylglucoside) → {2-[5,7-dihydroxy-2-(4-hydroxyphenyl)-4-oxo-3,4-dihydro-2H-1-benzopyran-8-yl]-5-hydroxy-6-(hydroxymethyl)-3-[(3,4,5-trihydroxy-6-methyloxan-2-yl)oxy]oxan-4-yl}oxidanesulfonic acid details
5,7-dihydroxy-2-(4-hydroxyphenyl)-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-3,4-dihydro-2H-1-benzopyran-4-one → ({6-[5,7-dihydroxy-2-(4-hydroxyphenyl)-4-oxo-3,4-dihydro-2H-1-benzopyran-8-yl]-3,4,5-trihydroxyoxan-2-yl}methoxy)sulfonic acid details
5,7-dihydroxy-2-(4-hydroxyphenyl)-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-3,4-dihydro-2H-1-benzopyran-4-one → {6-[5,7-dihydroxy-2-(4-hydroxyphenyl)-4-oxo-3,4-dihydro-2H-1-benzopyran-8-yl]-4,5-dihydroxy-2-(hydroxymethyl)oxan-3-yl}oxidanesulfonic acid details
5,7-dihydroxy-2-(4-hydroxyphenyl)-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-3,4-dihydro-2H-1-benzopyran-4-one → {2-[5,7-dihydroxy-2-(4-hydroxyphenyl)-4-oxo-3,4-dihydro-2H-1-benzopyran-8-yl]-3,5-dihydroxy-6-(hydroxymethyl)oxan-4-yl}oxidanesulfonic acid details
5,7-dihydroxy-2-(4-hydroxyphenyl)-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-3,4-dihydro-2H-1-benzopyran-4-one → {2-[5,7-dihydroxy-2-(4-hydroxyphenyl)-4-oxo-3,4-dihydro-2H-1-benzopyran-8-yl]-4,5-dihydroxy-6-(hydroxymethyl)oxan-3-yl}oxidanesulfonic acid details
5,7-dihydroxy-2-phenyl-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-3,4-dihydro-2H-1-benzopyran-4-one → {[6-(5,7-dihydroxy-4-oxo-2-phenyl-3,4-dihydro-2H-1-benzopyran-8-yl)-3,4,5-trihydroxyoxan-2-yl]methoxy}sulfonic acid details
5,7-dihydroxy-2-phenyl-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-3,4-dihydro-2H-1-benzopyran-4-one → [6-(5,7-dihydroxy-4-oxo-2-phenyl-3,4-dihydro-2H-1-benzopyran-8-yl)-4,5-dihydroxy-2-(hydroxymethyl)oxan-3-yl]oxidanesulfonic acid details
5,7-dihydroxy-2-phenyl-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-3,4-dihydro-2H-1-benzopyran-4-one → [2-(5,7-dihydroxy-4-oxo-2-phenyl-3,4-dihydro-2H-1-benzopyran-8-yl)-3,5-dihydroxy-6-(hydroxymethyl)oxan-4-yl]oxidanesulfonic acid details
5,7-dihydroxy-2-phenyl-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-3,4-dihydro-2H-1-benzopyran-4-one → [2-(5,7-dihydroxy-4-oxo-2-phenyl-3,4-dihydro-2H-1-benzopyran-8-yl)-4,5-dihydroxy-6-(hydroxymethyl)oxan-3-yl]oxidanesulfonic acid details
Cinchonain Id 7-glucoside → [6,12-bis(3,4-dihydroxyphenyl)-4-oxo-8-{[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxy}-3,11-dioxatricyclo[8.4.0.0²,⁷]tetradeca-1,7,9-trien-13-yl]oxidanesulfonic acid details
6,12-bis(3,4-dihydroxyphenyl)-8,13-dihydroxy-3,11-dioxatricyclo[8.4.0.0²,⁷]tetradeca-1(10),2(7),8-trien-4-one → [6,12-bis(3,4-dihydroxyphenyl)-8-hydroxy-4-oxo-3,11-dioxatricyclo[8.4.0.0²,⁷]tetradeca-1(10),2(7),8-trien-13-yl]oxidanesulfonic acid details
Liquiritigenin 4'-[3-acetylapiosyl-(1->2)-glucoside] → {[3-(acetyloxy)-5-({4,5-dihydroxy-2-[4-(7-hydroxy-4-oxo-3,4-dihydro-2H-1-benzopyran-2-yl)phenoxy]-6-(hydroxymethyl)oxan-3-yl}oxy)-4-hydroxyoxolan-3-yl]methoxy}sulfonic acid details
Liquiritigenin 4'-[3-acetylapiosyl-(1->2)-glucoside] → [4-(acetyloxy)-2-({4,5-dihydroxy-2-[4-(7-hydroxy-4-oxo-3,4-dihydro-2H-1-benzopyran-2-yl)phenoxy]-6-(hydroxymethyl)oxan-3-yl}oxy)-4-(hydroxymethyl)oxolan-3-yl]oxidanesulfonic acid details
3,4-Dihydroxyphenyllactic acid methyl ester → {[3-(3,4-dihydroxyphenyl)-1-methoxy-1-oxopropan-2-yl]oxy}sulfonic acid details
6''-Acetylapiin → {[5-({6-[(acetyloxy)methyl]-4,5-dihydroxy-2-{[5-hydroxy-2-(4-hydroxyphenyl)-4-oxo-4H-chromen-7-yl]oxy}oxan-3-yl}oxy)-3,4-dihydroxyoxolan-3-yl]methoxy}sulfonic acid details
6''-Acetylapiin → [2-({6-[(acetyloxy)methyl]-4,5-dihydroxy-2-{[5-hydroxy-2-(4-hydroxyphenyl)-4-oxo-4H-chromen-7-yl]oxy}oxan-3-yl}oxy)-4-hydroxy-4-(hydroxymethyl)oxolan-3-yl]oxidanesulfonic acid details
2-[4,6-dihydroxy-3-(4-hydroxy-3-methylbut-2-en-1-yl)-2-methoxyphenyl]-1-(2,4-dihydroxyphenyl)ethan-1-one → [(4-{3-[2-(2,4-dihydroxyphenyl)-2-oxoethyl]-4,6-dihydroxy-2-methoxyphenyl}-2-methylbut-2-en-1-yl)oxy]sulfonic acid details
2-[4,6-dihydroxy-3-(4-hydroxy-3-methylbut-2-en-1-yl)-2-methoxyphenyl]acetic acid → 2-{4,6-dihydroxy-2-methoxy-3-[3-methyl-4-(sulfooxy)but-2-en-1-yl]phenyl}acetic acid details
2-[4,6-dihydroxy-2-methoxy-3-(3-methylbut-2-en-1-yl)phenyl]-2-hydroxyacetic acid → 2-[4,6-dihydroxy-2-methoxy-3-(3-methylbut-2-en-1-yl)phenyl]-2-(sulfooxy)acetic acid details
Isolicopyranocoumarin → [7-(2,4-dihydroxyphenyl)-5-methoxy-2,2-dimethyl-8-oxo-2H,3H,4H,8H-pyrano[3,2-g]chromen-3-yl]oxidanesulfonic acid details
2,5-bis(hydroxymethyl)oxolane-2,3,4-triol → {[2,3,4-trihydroxy-5-(hydroxymethyl)oxolan-2-yl]methoxy}sulfonic acid details
2,5-bis(hydroxymethyl)oxolane-2,3,4-triol → {[3,4,5-trihydroxy-5-(hydroxymethyl)oxolan-2-yl]methoxy}sulfonic acid details
2,5-bis(hydroxymethyl)oxolane-2,3,4-triol → [4,5-dihydroxy-2,5-bis(hydroxymethyl)oxolan-3-yl]oxidanesulfonic acid details
2,5-bis(hydroxymethyl)oxolane-2,3,4-triol → [2,4-dihydroxy-2,5-bis(hydroxymethyl)oxolan-3-yl]oxidanesulfonic acid details
2-{[3,4-dihydroxy-2,5-bis(hydroxymethyl)oxolan-2-yl]oxy}-6-(hydroxymethyl)oxane-3,4,5-triol → {[3,4-dihydroxy-5-(hydroxymethyl)-2-{[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxy}oxolan-2-yl]methoxy}sulfonic acid details
2-{[3,4-dihydroxy-2,5-bis(hydroxymethyl)oxolan-2-yl]oxy}-6-(hydroxymethyl)oxane-3,4,5-triol → {[3,4-dihydroxy-5-(hydroxymethyl)-5-{[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxy}oxolan-2-yl]methoxy}sulfonic acid details
2-{[3,4-dihydroxy-2,5-bis(hydroxymethyl)oxolan-2-yl]oxy}-6-(hydroxymethyl)oxane-3,4,5-triol → [4-hydroxy-2,5-bis(hydroxymethyl)-5-{[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxy}oxolan-3-yl]oxidanesulfonic acid details
2-{[3,4-dihydroxy-2,5-bis(hydroxymethyl)oxolan-2-yl]oxy}-6-(hydroxymethyl)oxane-3,4,5-triol → [4-hydroxy-2,5-bis(hydroxymethyl)-2-{[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxy}oxolan-3-yl]oxidanesulfonic acid details
1-(4,5-dihydroxy-7-methoxy-2,2-dimethyl-3,4-dihydro-2H-1-benzopyran-6-yl)-3-(4-hydroxyphenyl)propan-1-one → {5-hydroxy-6-[3-(4-hydroxyphenyl)propanoyl]-7-methoxy-2,2-dimethyl-3,4-dihydro-2H-1-benzopyran-4-yl}oxidanesulfonic acid details
7-methoxy-2,2-dimethyl-3,4-dihydro-2H-1-benzopyran-4,5-diol → (5-hydroxy-7-methoxy-2,2-dimethyl-3,4-dihydro-2H-1-benzopyran-4-yl)oxidanesulfonic acid details
7-methoxy-2,2-dimethyl-3,4-dihydro-2H-1-benzopyran-4,5,6-triol → (5,6-dihydroxy-7-methoxy-2,2-dimethyl-3,4-dihydro-2H-1-benzopyran-4-yl)oxidanesulfonic acid details
2,2-dimethyl-3,4-dihydro-2H-1-benzopyran-4,5,7-triol → (5,7-dihydroxy-2,2-dimethyl-3,4-dihydro-2H-1-benzopyran-4-yl)oxidanesulfonic acid details
2-(hydroxymethyl)-7-methoxy-2-methyl-3,4-dihydro-2H-1-benzopyran-4,5-diol → [(4,5-dihydroxy-7-methoxy-2-methyl-3,4-dihydro-2H-1-benzopyran-2-yl)methoxy]sulfonic acid details
2-(hydroxymethyl)-7-methoxy-2-methyl-3,4-dihydro-2H-1-benzopyran-4,5-diol → [5-hydroxy-2-(hydroxymethyl)-7-methoxy-2-methyl-3,4-dihydro-2H-1-benzopyran-4-yl]oxidanesulfonic acid details
1-(4,5-dihydroxy-7-methoxy-2,2-dimethyl-3,4-dihydro-2H-1-benzopyran-6-yl)-3-phenylprop-2-en-1-one → [5-hydroxy-7-methoxy-2,2-dimethyl-6-(3-phenylprop-2-enoyl)-3,4-dihydro-2H-1-benzopyran-4-yl]oxidanesulfonic acid details
1-(4,5-dihydroxy-7-methoxy-2,2-dimethyl-3,4-dihydro-2H-1-benzopyran-6-yl)-3-phenylpropan-1-one → [5-hydroxy-7-methoxy-2,2-dimethyl-6-(3-phenylpropanoyl)-3,4-dihydro-2H-1-benzopyran-4-yl]oxidanesulfonic acid details
3-[2-(hydroxymethyl)-5-methoxy-2-methyl-2H-chromen-6-yl]-1-(4-hydroxyphenyl)prop-2-en-1-one → ({6-[3-(4-hydroxyphenyl)-3-oxoprop-1-en-1-yl]-5-methoxy-2-methyl-2H-chromen-2-yl}methoxy)sulfonic acid details
4-[1-hydroxy-3-(5-methoxy-2,2-dimethyl-2H-chromen-6-yl)prop-2-en-1-yl]phenol → {[1-(4-hydroxyphenyl)-3-(5-methoxy-2,2-dimethyl-2H-chromen-6-yl)prop-2-en-1-yl]oxy}sulfonic acid details
3-[2-(hydroxymethyl)-5-methoxy-2-methyl-2H-chromen-6-yl]-1-(4-hydroxyphenyl)propan-1-one → ({6-[3-(4-hydroxyphenyl)-3-oxopropyl]-5-methoxy-2-methyl-2H-chromen-2-yl}methoxy)sulfonic acid details
3-hydroxy-1-(4-hydroxyphenyl)-3-(5-methoxy-2,2-dimethyl-2H-chromen-6-yl)propan-1-one → [3-(4-hydroxyphenyl)-1-(5-methoxy-2,2-dimethyl-2H-chromen-6-yl)-3-oxopropoxy]sulfonic acid details
4-[1-hydroxy-3-(5-methoxy-2,2-dimethyl-2H-chromen-6-yl)propyl]phenol → [1-(4-hydroxyphenyl)-3-(5-methoxy-2,2-dimethyl-2H-chromen-6-yl)propoxy]sulfonic acid details
Epicatechin-(4beta->6)-epicatechin-(2beta->7,4beta->8)-epicatechin → {4-[5,13-bis(3,4-dihydroxyphenyl)-6,9,17,19,21-pentahydroxy-4,12,14-trioxapentacyclo[11.7.1.0²,¹¹.0³,⁸.0¹⁵,²⁰]henicosa-2(11),3(8),9,15(20),16,18-hexaen-18-yl]-2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-3,4-dihydro-2H-1-benzopyran-3-yl}oxidanesulfonic acid details
Epicatechin-(4beta->6)-epicatechin-(2beta->7,4beta->8)-epicatechin → [5,13-bis(3,4-dihydroxyphenyl)-18-[2-(3,4-dihydroxyphenyl)-3,5,7-trihydroxy-3,4-dihydro-2H-1-benzopyran-4-yl]-6,9,17,19-tetrahydroxy-4,12,14-trioxapentacyclo[11.7.1.0²,¹¹.0³,⁸.0¹⁵,²⁰]henicosa-2(11),3(8),9,15(20),16,18-hexaen-21-yl]oxidanesulfonic acid details
Epicatechin-(4beta->6)-epicatechin-(2beta->7,4beta->8)-epicatechin → [5,13-bis(3,4-dihydroxyphenyl)-18-[2-(3,4-dihydroxyphenyl)-3,5,7-trihydroxy-3,4-dihydro-2H-1-benzopyran-4-yl]-9,17,19,21-tetrahydroxy-4,12,14-trioxapentacyclo[11.7.1.0²,¹¹.0³,⁸.0¹⁵,²⁰]henicosa-2(11),3(8),9,15(20),16,18-hexaen-6-yl]oxidanesulfonic acid details
5,13-bis(3,4-dihydroxyphenyl)-18-[3,5,7-trihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-yl]-4,12,14-trioxapentacyclo[11.7.1.0²,¹¹.0³,⁸.0¹⁵,²⁰]henicosa-2(11),3(8),9,15(20),16,18-hexaene-6,9,17,19,21-pentol → {4-[5,13-bis(3,4-dihydroxyphenyl)-6,9,17,19,21-pentahydroxy-4,12,14-trioxapentacyclo[11.7.1.0²,¹¹.0³,⁸.0¹⁵,²⁰]henicosa-2(11),3(8),9,15(20),16,18-hexaen-18-yl]-5,7-dihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-3-yl}oxidanesulfonic acid details
5,13-bis(3,4-dihydroxyphenyl)-18-[3,5,7-trihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-yl]-4,12,14-trioxapentacyclo[11.7.1.0²,¹¹.0³,⁸.0¹⁵,²⁰]henicosa-2(11),3(8),9,15(20),16,18-hexaene-6,9,17,19,21-pentol → [5,13-bis(3,4-dihydroxyphenyl)-6,9,17,19-tetrahydroxy-18-[3,5,7-trihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-yl]-4,12,14-trioxapentacyclo[11.7.1.0²,¹¹.0³,⁸.0¹⁵,²⁰]henicosa-2(11),3(8),9,15(20),16,18-hexaen-21-yl]oxidanesulfonic acid details
5,13-bis(3,4-dihydroxyphenyl)-18-[3,5,7-trihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-yl]-4,12,14-trioxapentacyclo[11.7.1.0²,¹¹.0³,⁸.0¹⁵,²⁰]henicosa-2(11),3(8),9,15(20),16,18-hexaene-6,9,17,19,21-pentol → [5,13-bis(3,4-dihydroxyphenyl)-9,17,19,21-tetrahydroxy-18-[3,5,7-trihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-yl]-4,12,14-trioxapentacyclo[11.7.1.0²,¹¹.0³,⁸.0¹⁵,²⁰]henicosa-2(11),3(8),9,15(20),16,18-hexaen-6-yl]oxidanesulfonic acid details
18-[2-(3,4-dihydroxyphenyl)-3,5,7-trihydroxy-3,4-dihydro-2H-1-benzopyran-4-yl]-5,13-bis(3-hydroxyphenyl)-4,12,14-trioxapentacyclo[11.7.1.0²,¹¹.0³,⁸.0¹⁵,²⁰]henicosa-2(11),3(8),9,15(20),16,18-hexaene-6,9,17,19,21-pentol → [2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-4-[6,9,17,19,21-pentahydroxy-5,13-bis(3-hydroxyphenyl)-4,12,14-trioxapentacyclo[11.7.1.0²,¹¹.0³,⁸.0¹⁵,²⁰]henicosa-2(11),3(8),9,15(20),16,18-hexaen-18-yl]-3,4-dihydro-2H-1-benzopyran-3-yl]oxidanesulfonic acid details
18-[2-(3,4-dihydroxyphenyl)-3,5,7-trihydroxy-3,4-dihydro-2H-1-benzopyran-4-yl]-5,13-bis(3-hydroxyphenyl)-4,12,14-trioxapentacyclo[11.7.1.0²,¹¹.0³,⁸.0¹⁵,²⁰]henicosa-2(11),3(8),9,15(20),16,18-hexaene-6,9,17,19,21-pentol → {18-[2-(3,4-dihydroxyphenyl)-3,5,7-trihydroxy-3,4-dihydro-2H-1-benzopyran-4-yl]-6,9,17,19-tetrahydroxy-5,13-bis(3-hydroxyphenyl)-4,12,14-trioxapentacyclo[11.7.1.0²,¹¹.0³,⁸.0¹⁵,²⁰]henicosa-2(11),3(8),9,15(20),16,18-hexaen-21-yl}oxidanesulfonic acid details
18-[2-(3,4-dihydroxyphenyl)-3,5,7-trihydroxy-3,4-dihydro-2H-1-benzopyran-4-yl]-5,13-bis(3-hydroxyphenyl)-4,12,14-trioxapentacyclo[11.7.1.0²,¹¹.0³,⁸.0¹⁵,²⁰]henicosa-2(11),3(8),9,15(20),16,18-hexaene-6,9,17,19,21-pentol → {18-[2-(3,4-dihydroxyphenyl)-3,5,7-trihydroxy-3,4-dihydro-2H-1-benzopyran-4-yl]-9,17,19,21-tetrahydroxy-5,13-bis(3-hydroxyphenyl)-4,12,14-trioxapentacyclo[11.7.1.0²,¹¹.0³,⁸.0¹⁵,²⁰]henicosa-2(11),3(8),9,15(20),16,18-hexaen-6-yl}oxidanesulfonic acid details
5,13-bis(3-hydroxyphenyl)-18-[3,5,7-trihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-yl]-4,12,14-trioxapentacyclo[11.7.1.0²,¹¹.0³,⁸.0¹⁵,²⁰]henicosa-2(11),3(8),9,15(20),16,18-hexaene-6,9,17,19,21-pentol → [5,7-dihydroxy-2-(3-hydroxyphenyl)-4-[6,9,17,19,21-pentahydroxy-5,13-bis(3-hydroxyphenyl)-4,12,14-trioxapentacyclo[11.7.1.0²,¹¹.0³,⁸.0¹⁵,²⁰]henicosa-2(11),3(8),9,15(20),16,18-hexaen-18-yl]-3,4-dihydro-2H-1-benzopyran-3-yl]oxidanesulfonic acid details
5,13-bis(3-hydroxyphenyl)-18-[3,5,7-trihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-yl]-4,12,14-trioxapentacyclo[11.7.1.0²,¹¹.0³,⁸.0¹⁵,²⁰]henicosa-2(11),3(8),9,15(20),16,18-hexaene-6,9,17,19,21-pentol → [6,9,17,19-tetrahydroxy-5,13-bis(3-hydroxyphenyl)-18-[3,5,7-trihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-yl]-4,12,14-trioxapentacyclo[11.7.1.0²,¹¹.0³,⁸.0¹⁵,²⁰]henicosa-2(11),3(8),9,15(20),16,18-hexaen-21-yl]oxidanesulfonic acid details
5,13-bis(3-hydroxyphenyl)-18-[3,5,7-trihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-yl]-4,12,14-trioxapentacyclo[11.7.1.0²,¹¹.0³,⁸.0¹⁵,²⁰]henicosa-2(11),3(8),9,15(20),16,18-hexaene-6,9,17,19,21-pentol → [9,17,19,21-tetrahydroxy-5,13-bis(3-hydroxyphenyl)-18-[3,5,7-trihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-yl]-4,12,14-trioxapentacyclo[11.7.1.0²,¹¹.0³,⁸.0¹⁵,²⁰]henicosa-2(11),3(8),9,15(20),16,18-hexaen-6-yl]oxidanesulfonic acid details
2-[4,6-dihydroxy-3-(4-hydroxy-3-methylbut-2-en-1-yl)-2-methoxyphenyl]-6-hydroxy-2,3-dihydro-1-benzofuran-3-one → ({4-[4,6-dihydroxy-3-(6-hydroxy-3-oxo-2,3-dihydro-1-benzofuran-2-yl)-2-methoxyphenyl]-2-methylbut-2-en-1-yl}oxy)sulfonic acid details
3-(3,7-dihydroxy-5-methoxy-2,2-dimethyl-3,4-dihydro-2H-1-benzopyran-6-yl)-7-hydroxy-4H-chromen-4-one → [7-hydroxy-6-(7-hydroxy-4-oxo-4H-chromen-3-yl)-5-methoxy-2,2-dimethyl-3,4-dihydro-2H-1-benzopyran-3-yl]oxidanesulfonic acid details
7-hydroxy-3-[7-hydroxy-2-(hydroxymethyl)-5-methoxy-2-methyl-3,4-dihydro-2H-1-benzopyran-6-yl]-4H-chromen-4-one → {[7-hydroxy-6-(7-hydroxy-4-oxo-4H-chromen-3-yl)-5-methoxy-2-methyl-3,4-dihydro-2H-1-benzopyran-2-yl]methoxy}sulfonic acid details
Glycyrrhizaflavonol A → [2,2-dimethyl-6-(3,5,7-trihydroxy-4-oxo-4H-chromen-2-yl)-3,4-dihydro-2H-1-benzopyran-3-yl]oxidanesulfonic acid details
4,5-dihydroxy-11-methoxy-6,8,19-trioxapentacyclo[10.7.0.0²,⁹.0³,⁷.0¹³,¹⁷]nonadeca-1(12),2(9),10,13(17)-tetraene-16,18-dione → {5-hydroxy-11-methoxy-16,18-dioxo-6,8,19-trioxapentacyclo[10.7.0.0²,⁹.0³,⁷.0¹³,¹⁷]nonadeca-1(12),2(9),10,13(17)-tetraen-4-yl}oxidanesulfonic acid details
5,14-dihydroxy-11-methoxy-6,8,19-trioxapentacyclo[10.7.0.0²,⁹.0³,⁷.0¹³,¹⁷]nonadeca-1(12),2(9),10,13(17)-tetraene-16,18-dione → {5-hydroxy-11-methoxy-16,18-dioxo-6,8,19-trioxapentacyclo[10.7.0.0²,⁹.0³,⁷.0¹³,¹⁷]nonadeca-1(12),2(9),10,13(17)-tetraen-14-yl}oxidanesulfonic acid details
5-hydroxy-8-(hydroxymethyl)-8-methyl-6-(2-methylpropanoyl)-4-phenyl-2H,8H-pyrano[2,3-f]chromen-2-one → {[5-hydroxy-8-methyl-6-(2-methylpropanoyl)-2-oxo-4-phenyl-2H,8H-pyrano[2,3-f]chromen-8-yl]methoxy}sulfonic acid details
5-hydroxy-6-(3-hydroxy-2-methylpropanoyl)-8,8-dimethyl-4-phenyl-2H,8H-pyrano[2,3-f]chromen-2-one → (3-{5-hydroxy-8,8-dimethyl-2-oxo-4-phenyl-2H,8H-pyrano[2,3-f]chromen-6-yl}-2-methyl-3-oxopropoxy)sulfonic acid details
2-{2,6-dihydroxy-4-[6-hydroxy-7-(3-methylbut-2-en-1-yl)-1-benzofuran-2-yl]phenyl}-6-(2,4-dihydroxyphenyl)-4-(hydroxymethyl)cyclohex-3-ene-1-carboxylic acid → 2-{2,6-dihydroxy-4-[6-hydroxy-7-(3-methylbut-2-en-1-yl)-1-benzofuran-2-yl]phenyl}-6-(2,4-dihydroxyphenyl)-4-[(sulfooxy)methyl]cyclohex-3-ene-1-carboxylic acid details
2-{2,6-dihydroxy-4-[6-hydroxy-7-(3-methylbut-2-en-1-yl)-1-benzofuran-2-yl]phenyl}-6-(2,4-dihydroxyphenyl)-5-hydroxy-4-methylcyclohex-3-ene-1-carboxylic acid → 2-{2,6-dihydroxy-4-[6-hydroxy-7-(3-methylbut-2-en-1-yl)-1-benzofuran-2-yl]phenyl}-6-(2,4-dihydroxyphenyl)-4-methyl-5-(sulfooxy)cyclohex-3-ene-1-carboxylic acid details
2-{2,6-dihydroxy-4-[6-hydroxy-7-(4-hydroxy-3-methylbut-2-en-1-yl)-1-benzofuran-2-yl]phenyl}-6-(2,4-dihydroxyphenyl)-4-methylcyclohex-3-ene-1-carboxylic acid → 2-(2,6-dihydroxy-4-{6-hydroxy-7-[3-methyl-4-(sulfooxy)but-2-en-1-yl]-1-benzofuran-2-yl}phenyl)-6-(2,4-dihydroxyphenyl)-4-methylcyclohex-3-ene-1-carboxylic acid details
2-(2,6-dihydroxy-4-{6-hydroxy-7-[(2E)-4-hydroxy-3-methylbut-2-en-1-yl]-1-benzofuran-2-yl}phenyl)-6-(2,4-dihydroxyphenyl)-4-methylcyclohex-3-ene-1-carboxylic acid → 2-(2,6-dihydroxy-4-{6-hydroxy-7-[(2E)-3-methyl-4-(sulfooxy)but-2-en-1-yl]-1-benzofuran-2-yl}phenyl)-6-(2,4-dihydroxyphenyl)-4-methylcyclohex-3-ene-1-carboxylic acid details
2-(4-hydroxy-3-methylbut-2-en-1-yl)benzene-1,3-diol → {[4-(2,6-dihydroxyphenyl)-2-methylbut-2-en-1-yl]oxy}sulfonic acid details
2-{6-[2,4-dihydroxy-3-(3-methylbut-2-en-1-yl)benzoyl]-5-(2,4-dihydroxyphenyl)-3-(hydroxymethyl)cyclohex-2-en-1-yl}-5-[(E)-2-(2,4-dihydroxyphenyl)ethenyl]benzene-1,3-diol → ({4-[2,4-dihydroxy-3-(3-methylbut-2-en-1-yl)benzoyl]-5-(2,4-dihydroxyphenyl)-3-{4-[(E)-2-(2,4-dihydroxyphenyl)ethenyl]-2,6-dihydroxyphenyl}cyclohex-1-en-1-yl}methoxy)sulfonic acid details
2-{6-[2,4-dihydroxy-3-(3-methylbut-2-en-1-yl)benzoyl]-5-(2,4-dihydroxyphenyl)-4-hydroxy-3-methylcyclohex-2-en-1-yl}-5-[(E)-2-(2,4-dihydroxyphenyl)ethenyl]benzene-1,3-diol → {5-[2,4-dihydroxy-3-(3-methylbut-2-en-1-yl)benzoyl]-6-(2,4-dihydroxyphenyl)-4-{4-[(E)-2-(2,4-dihydroxyphenyl)ethenyl]-2,6-dihydroxyphenyl}-2-methylcyclohex-2-en-1-yl}oxidanesulfonic acid details
2-{6-[2,4-dihydroxy-3-(4-hydroxy-3-methylbut-2-en-1-yl)benzoyl]-5-(2,4-dihydroxyphenyl)-3-methylcyclohex-2-en-1-yl}-5-[(E)-2-(2,4-dihydroxyphenyl)ethenyl]benzene-1,3-diol → [(4-{3-[6-(2,4-dihydroxyphenyl)-2-{4-[(E)-2-(2,4-dihydroxyphenyl)ethenyl]-2,6-dihydroxyphenyl}-4-methylcyclohex-3-ene-1-carbonyl]-2,6-dihydroxyphenyl}-2-methylbut-2-en-1-yl)oxy]sulfonic acid details
2-(6-{2,4-dihydroxy-3-[(2E)-4-hydroxy-3-methylbut-2-en-1-yl]benzoyl}-5-(2,4-dihydroxyphenyl)-3-methylcyclohex-2-en-1-yl)-5-[(E)-2-(2,4-dihydroxyphenyl)ethenyl]benzene-1,3-diol → {[(2E)-4-{3-[6-(2,4-dihydroxyphenyl)-2-{4-[(E)-2-(2,4-dihydroxyphenyl)ethenyl]-2,6-dihydroxyphenyl}-4-methylcyclohex-3-ene-1-carbonyl]-2,6-dihydroxyphenyl}-2-methylbut-2-en-1-yl]oxy}sulfonic acid details
2-[(2E)-4-hydroxy-3-methylbut-2-en-1-yl]benzene-1,3-diol → {[(2E)-4-(2,6-dihydroxyphenyl)-2-methylbut-2-en-1-yl]oxy}sulfonic acid details
2-(hydroxymethyl)-2-methyl-2H-chromen-5-ol → [(5-hydroxy-2-methyl-2H-chromen-2-yl)methoxy]sulfonic acid details
2-(phenylmethylidene)heptane-1,3-diol → {[3-hydroxy-2-(phenylmethylidene)heptyl]oxy}sulfonic acid details
2-(phenylmethylidene)heptane-1,3-diol → {[1-hydroxy-2-(phenylmethylidene)heptan-3-yl]oxy}sulfonic acid details
3-[(1Z)-3-hydroxy-2-pentylprop-1-en-1-yl]phenol → {[(2Z)-2-[(3-hydroxyphenyl)methylidene]heptyl]oxy}sulfonic acid details
4-[(1Z)-3-hydroxy-2-pentylprop-1-en-1-yl]phenol → {[(2Z)-2-[(4-hydroxyphenyl)methylidene]heptyl]oxy}sulfonic acid details
(2Z)-2-(phenylmethylidene)heptane-1,6-diol → {[(2Z)-6-hydroxy-2-(phenylmethylidene)heptyl]oxy}sulfonic acid details
(2Z)-2-(phenylmethylidene)heptane-1,6-diol → {[(6Z)-7-hydroxy-6-(phenylmethylidene)heptan-2-yl]oxy}sulfonic acid details
(2-pentyl-3-phenyloxiran-2-yl)methanol → [(2-pentyl-3-phenyloxiran-2-yl)methoxy]sulfonic acid details
(2Z)-2-(phenylmethylidene)heptane-1,7-diol → {[(6Z)-7-hydroxy-6-(phenylmethylidene)heptyl]oxy}sulfonic acid details
(2Z)-2-(phenylmethylidene)heptane-1,7-diol → {[(2Z)-7-hydroxy-2-(phenylmethylidene)heptyl]oxy}sulfonic acid details
Tetrahydro-2-furanmethanol → [(oxolan-2-yl)methoxy]sulfonic acid details
Dihydroisorhamnetin → [5,7-dihydroxy-2-(4-hydroxy-3-methoxyphenyl)-4-oxo-3,4-dihydro-2H-1-benzopyran-3-yl]oxidanesulfonic acid details
3,5,7-trihydroxy-2-(3-methoxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-one → [5,7-dihydroxy-2-(3-methoxyphenyl)-4-oxo-3,4-dihydro-2H-1-benzopyran-3-yl]oxidanesulfonic acid details
5,7-dihydroxy-2-(4-hydroxy-3-methoxyphenyl)-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → ({6-[5,7-dihydroxy-2-(4-hydroxy-3-methoxyphenyl)-4-oxo-4H-chromen-6-yl]-3,4,5-trihydroxyoxan-2-yl}methoxy)sulfonic acid details
5,7-dihydroxy-2-(4-hydroxy-3-methoxyphenyl)-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → {6-[5,7-dihydroxy-2-(4-hydroxy-3-methoxyphenyl)-4-oxo-4H-chromen-6-yl]-4,5-dihydroxy-2-(hydroxymethyl)oxan-3-yl}oxidanesulfonic acid details
5,7-dihydroxy-2-(4-hydroxy-3-methoxyphenyl)-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → {2-[5,7-dihydroxy-2-(4-hydroxy-3-methoxyphenyl)-4-oxo-4H-chromen-6-yl]-3,5-dihydroxy-6-(hydroxymethyl)oxan-4-yl}oxidanesulfonic acid details
5,7-dihydroxy-2-(4-hydroxy-3-methoxyphenyl)-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → {2-[5,7-dihydroxy-2-(4-hydroxy-3-methoxyphenyl)-4-oxo-4H-chromen-6-yl]-4,5-dihydroxy-6-(hydroxymethyl)oxan-3-yl}oxidanesulfonic acid details
5,7-dihydroxy-2-(3-methoxyphenyl)-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → ({6-[5,7-dihydroxy-2-(3-methoxyphenyl)-4-oxo-4H-chromen-6-yl]-3,4,5-trihydroxyoxan-2-yl}methoxy)sulfonic acid details
5,7-dihydroxy-2-(3-methoxyphenyl)-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → {6-[5,7-dihydroxy-2-(3-methoxyphenyl)-4-oxo-4H-chromen-6-yl]-4,5-dihydroxy-2-(hydroxymethyl)oxan-3-yl}oxidanesulfonic acid details
5,7-dihydroxy-2-(3-methoxyphenyl)-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → {2-[5,7-dihydroxy-2-(3-methoxyphenyl)-4-oxo-4H-chromen-6-yl]-3,5-dihydroxy-6-(hydroxymethyl)oxan-4-yl}oxidanesulfonic acid details
5,7-dihydroxy-2-(3-methoxyphenyl)-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → {2-[5,7-dihydroxy-2-(3-methoxyphenyl)-4-oxo-4H-chromen-6-yl]-4,5-dihydroxy-6-(hydroxymethyl)oxan-3-yl}oxidanesulfonic acid details
7,8,8,12,13,21,22-heptahydroxy-19-(hydroxymethyl)-2,17,20,23-tetraoxapentacyclo[16.3.1.1⁷,¹¹.0⁴,⁹.0¹⁰,¹⁵]tricosa-4,10,12,14-tetraene-3,6,16-trione → [7,8,8,12,13,21-hexahydroxy-19-(hydroxymethyl)-3,6,16-trioxo-2,17,20,23-tetraoxapentacyclo[16.3.1.1⁷,¹¹.0⁴,⁹.0¹⁰,¹⁵]tricosa-4,10,12,14-tetraen-22-yl]oxidanesulfonic acid details
7,8,8,12,13,22-hexahydroxy-19-(hydroxymethyl)-3,6,16-trioxo-2,17,20,23-tetraoxapentacyclo[16.3.1.1⁷,¹¹.0⁴,⁹.0¹⁰,¹⁵]tricosa-4,10,12,14-tetraen-21-yl 3,4,5-trihydroxybenzoate → [7,8,8,12,13-pentahydroxy-19-(hydroxymethyl)-3,6,16-trioxo-21-(3,4,5-trihydroxybenzoyloxy)-2,17,20,23-tetraoxapentacyclo[16.3.1.1⁷,¹¹.0⁴,⁹.0¹⁰,¹⁵]tricosa-4,10,12,14-tetraen-22-yl]oxidanesulfonic acid details
(+)-Catechin 6-C-glucoside → ({6-[2-(3,4-dihydroxyphenyl)-3,5,7-trihydroxy-3,4-dihydro-2H-1-benzopyran-6-yl]-3,4,5-trihydroxyoxan-2-yl}methoxy)sulfonic acid details
(+)-Catechin 6-C-glucoside → {6-[2-(3,4-dihydroxyphenyl)-3,5,7-trihydroxy-3,4-dihydro-2H-1-benzopyran-6-yl]-4,5-dihydroxy-2-(hydroxymethyl)oxan-3-yl}oxidanesulfonic acid details
(+)-Catechin 6-C-glucoside → {2-[2-(3,4-dihydroxyphenyl)-3,5,7-trihydroxy-3,4-dihydro-2H-1-benzopyran-6-yl]-3,5-dihydroxy-6-(hydroxymethyl)oxan-4-yl}oxidanesulfonic acid details
(+)-Catechin 6-C-glucoside → {2-[2-(3,4-dihydroxyphenyl)-3,5,7-trihydroxy-3,4-dihydro-2H-1-benzopyran-6-yl]-4,5-dihydroxy-6-(hydroxymethyl)oxan-3-yl}oxidanesulfonic acid details
6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-2-(2,4,5-trihydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-3,5,7-triol → ({3,4,5-trihydroxy-6-[3,5,7-trihydroxy-2-(2,4,5-trihydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-6-yl]oxan-2-yl}methoxy)sulfonic acid details
6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-2-(2,4,5-trihydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-3,5,7-triol → [4,5-dihydroxy-2-(hydroxymethyl)-6-[3,5,7-trihydroxy-2-(2,4,5-trihydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-6-yl]oxan-3-yl]oxidanesulfonic acid details
6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-2-(2,4,5-trihydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-3,5,7-triol → [3,5-dihydroxy-2-(hydroxymethyl)-6-[3,5,7-trihydroxy-2-(2,4,5-trihydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-6-yl]oxan-4-yl]oxidanesulfonic acid details
6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-2-(2,4,5-trihydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-3,5,7-triol → [4,5-dihydroxy-6-(hydroxymethyl)-2-[3,5,7-trihydroxy-2-(2,4,5-trihydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-6-yl]oxan-3-yl]oxidanesulfonic acid details
2-(3-hydroxyphenyl)-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-3,4-dihydro-2H-1-benzopyran-3,5,7-triol → ({3,4,5-trihydroxy-6-[3,5,7-trihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-6-yl]oxan-2-yl}methoxy)sulfonic acid details
2-(3-hydroxyphenyl)-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-3,4-dihydro-2H-1-benzopyran-3,5,7-triol → [4,5-dihydroxy-2-(hydroxymethyl)-6-[3,5,7-trihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-6-yl]oxan-3-yl]oxidanesulfonic acid details
2-(3-hydroxyphenyl)-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-3,4-dihydro-2H-1-benzopyran-3,5,7-triol → [3,5-dihydroxy-2-(hydroxymethyl)-6-[3,5,7-trihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-6-yl]oxan-4-yl]oxidanesulfonic acid details
2-(3-hydroxyphenyl)-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-3,4-dihydro-2H-1-benzopyran-3,5,7-triol → [4,5-dihydroxy-6-(hydroxymethyl)-2-[3,5,7-trihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-6-yl]oxan-3-yl]oxidanesulfonic acid details
(+)-Catechin 8-C-glucoside → ({6-[2-(3,4-dihydroxyphenyl)-3,5,7-trihydroxy-3,4-dihydro-2H-1-benzopyran-8-yl]-3,4,5-trihydroxyoxan-2-yl}methoxy)sulfonic acid details
(+)-Catechin 8-C-glucoside → {6-[2-(3,4-dihydroxyphenyl)-3,5,7-trihydroxy-3,4-dihydro-2H-1-benzopyran-8-yl]-4,5-dihydroxy-2-(hydroxymethyl)oxan-3-yl}oxidanesulfonic acid details
(+)-Catechin 8-C-glucoside → {2-[2-(3,4-dihydroxyphenyl)-3,5,7-trihydroxy-3,4-dihydro-2H-1-benzopyran-8-yl]-3,5-dihydroxy-6-(hydroxymethyl)oxan-4-yl}oxidanesulfonic acid details
(+)-Catechin 8-C-glucoside → {2-[2-(3,4-dihydroxyphenyl)-3,5,7-trihydroxy-3,4-dihydro-2H-1-benzopyran-8-yl]-4,5-dihydroxy-6-(hydroxymethyl)oxan-3-yl}oxidanesulfonic acid details
2-(3,4-dihydroxyphenyl)-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-3,4-dihydro-2H-1-benzopyran-3,5,6,7-tetrol → ({6-[2-(3,4-dihydroxyphenyl)-3,5,6,7-tetrahydroxy-3,4-dihydro-2H-1-benzopyran-8-yl]-3,4,5-trihydroxyoxan-2-yl}methoxy)sulfonic acid details
2-(3,4-dihydroxyphenyl)-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-3,4-dihydro-2H-1-benzopyran-3,5,6,7-tetrol → {6-[2-(3,4-dihydroxyphenyl)-3,5,6,7-tetrahydroxy-3,4-dihydro-2H-1-benzopyran-8-yl]-4,5-dihydroxy-2-(hydroxymethyl)oxan-3-yl}oxidanesulfonic acid details
2-(3,4-dihydroxyphenyl)-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-3,4-dihydro-2H-1-benzopyran-3,5,6,7-tetrol → {2-[2-(3,4-dihydroxyphenyl)-3,5,6,7-tetrahydroxy-3,4-dihydro-2H-1-benzopyran-8-yl]-3,5-dihydroxy-6-(hydroxymethyl)oxan-4-yl}oxidanesulfonic acid details
2-(3,4-dihydroxyphenyl)-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-3,4-dihydro-2H-1-benzopyran-3,5,6,7-tetrol → {2-[2-(3,4-dihydroxyphenyl)-3,5,6,7-tetrahydroxy-3,4-dihydro-2H-1-benzopyran-8-yl]-4,5-dihydroxy-6-(hydroxymethyl)oxan-3-yl}oxidanesulfonic acid details
8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-2-(2,4,5-trihydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-3,5,7-triol → ({3,4,5-trihydroxy-6-[3,5,7-trihydroxy-2-(2,4,5-trihydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-8-yl]oxan-2-yl}methoxy)sulfonic acid details
8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-2-(2,4,5-trihydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-3,5,7-triol → [4,5-dihydroxy-2-(hydroxymethyl)-6-[3,5,7-trihydroxy-2-(2,4,5-trihydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-8-yl]oxan-3-yl]oxidanesulfonic acid details
8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-2-(2,4,5-trihydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-3,5,7-triol → [3,5-dihydroxy-2-(hydroxymethyl)-6-[3,5,7-trihydroxy-2-(2,4,5-trihydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-8-yl]oxan-4-yl]oxidanesulfonic acid details
8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-2-(2,4,5-trihydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-3,5,7-triol → [4,5-dihydroxy-6-(hydroxymethyl)-2-[3,5,7-trihydroxy-2-(2,4,5-trihydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-8-yl]oxan-3-yl]oxidanesulfonic acid details
2-(3-hydroxyphenyl)-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-3,4-dihydro-2H-1-benzopyran-3,5,7-triol → ({3,4,5-trihydroxy-6-[3,5,7-trihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-8-yl]oxan-2-yl}methoxy)sulfonic acid details
2-(3-hydroxyphenyl)-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-3,4-dihydro-2H-1-benzopyran-3,5,7-triol → [4,5-dihydroxy-2-(hydroxymethyl)-6-[3,5,7-trihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-8-yl]oxan-3-yl]oxidanesulfonic acid details
2-(3-hydroxyphenyl)-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-3,4-dihydro-2H-1-benzopyran-3,5,7-triol → [3,5-dihydroxy-2-(hydroxymethyl)-6-[3,5,7-trihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-8-yl]oxan-4-yl]oxidanesulfonic acid details
2-(3-hydroxyphenyl)-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-3,4-dihydro-2H-1-benzopyran-3,5,7-triol → [4,5-dihydroxy-6-(hydroxymethyl)-2-[3,5,7-trihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-8-yl]oxan-3-yl]oxidanesulfonic acid details
2-(3-hydroxyphenyl)-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-3,4-dihydro-2H-1-benzopyran-3,5,6,7-tetrol → ({3,4,5-trihydroxy-6-[3,5,6,7-tetrahydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-8-yl]oxan-2-yl}methoxy)sulfonic acid details
2-(3-hydroxyphenyl)-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-3,4-dihydro-2H-1-benzopyran-3,5,6,7-tetrol → [4,5-dihydroxy-2-(hydroxymethyl)-6-[3,5,6,7-tetrahydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-8-yl]oxan-3-yl]oxidanesulfonic acid details
2-(3-hydroxyphenyl)-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-3,4-dihydro-2H-1-benzopyran-3,5,6,7-tetrol → [3,5-dihydroxy-2-(hydroxymethyl)-6-[3,5,6,7-tetrahydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-8-yl]oxan-4-yl]oxidanesulfonic acid details
2-(3-hydroxyphenyl)-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-3,4-dihydro-2H-1-benzopyran-3,5,6,7-tetrol → [4,5-dihydroxy-6-(hydroxymethyl)-2-[3,5,6,7-tetrahydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-8-yl]oxan-3-yl]oxidanesulfonic acid details
4-[2-(3,4-dihydroxyphenyl)-3,5,7-trihydroxy-3,4-dihydro-2H-1-benzopyran-8-yl]-2-(3-hydroxyphenyl)-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-3,4-dihydro-2H-1-benzopyran-3,5,7-triol → [(6-{4-[2-(3,4-dihydroxyphenyl)-3,5,7-trihydroxy-3,4-dihydro-2H-1-benzopyran-8-yl]-3,5,7-trihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-6-yl}-3,4,5-trihydroxyoxan-2-yl)methoxy]sulfonic acid details
4-[2-(3,4-dihydroxyphenyl)-3,5,7-trihydroxy-3,4-dihydro-2H-1-benzopyran-8-yl]-2-(3-hydroxyphenyl)-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-3,4-dihydro-2H-1-benzopyran-3,5,7-triol → {4-[2-(3,4-dihydroxyphenyl)-3,5,7-trihydroxy-3,4-dihydro-2H-1-benzopyran-8-yl]-5,7-dihydroxy-2-(3-hydroxyphenyl)-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-3,4-dihydro-2H-1-benzopyran-3-yl}oxidanesulfonic acid details
4-[2-(3,4-dihydroxyphenyl)-3,5,7-trihydroxy-3,4-dihydro-2H-1-benzopyran-8-yl]-2-(3-hydroxyphenyl)-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-3,4-dihydro-2H-1-benzopyran-3,5,7-triol → (6-{4-[2-(3,4-dihydroxyphenyl)-3,5,7-trihydroxy-3,4-dihydro-2H-1-benzopyran-8-yl]-3,5,7-trihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-6-yl}-4,5-dihydroxy-2-(hydroxymethyl)oxan-3-yl)oxidanesulfonic acid details
4-[2-(3,4-dihydroxyphenyl)-3,5,7-trihydroxy-3,4-dihydro-2H-1-benzopyran-8-yl]-2-(3-hydroxyphenyl)-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-3,4-dihydro-2H-1-benzopyran-3,5,7-triol → (2-{4-[2-(3,4-dihydroxyphenyl)-3,5,7-trihydroxy-3,4-dihydro-2H-1-benzopyran-8-yl]-3,5,7-trihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-6-yl}-3,5-dihydroxy-6-(hydroxymethyl)oxan-4-yl)oxidanesulfonic acid details
4-[2-(3,4-dihydroxyphenyl)-3,5,7-trihydroxy-3,4-dihydro-2H-1-benzopyran-8-yl]-2-(3-hydroxyphenyl)-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-3,4-dihydro-2H-1-benzopyran-3,5,7-triol → (2-{4-[2-(3,4-dihydroxyphenyl)-3,5,7-trihydroxy-3,4-dihydro-2H-1-benzopyran-8-yl]-3,5,7-trihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-6-yl}-4,5-dihydroxy-6-(hydroxymethyl)oxan-3-yl)oxidanesulfonic acid details
2-(3,4-dihydroxyphenyl)-4-[3,5,7-trihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-8-yl]-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-3,4-dihydro-2H-1-benzopyran-3,5,7-triol → ({6-[2-(3,4-dihydroxyphenyl)-3,5,7-trihydroxy-4-[3,5,7-trihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-8-yl]-3,4-dihydro-2H-1-benzopyran-6-yl]-3,4,5-trihydroxyoxan-2-yl}methoxy)sulfonic acid details
2-(3,4-dihydroxyphenyl)-4-[3,5,7-trihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-8-yl]-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-3,4-dihydro-2H-1-benzopyran-3,5,7-triol → [2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-4-[3,5,7-trihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-8-yl]-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-3,4-dihydro-2H-1-benzopyran-3-yl]oxidanesulfonic acid details
2-(3,4-dihydroxyphenyl)-4-[3,5,7-trihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-8-yl]-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-3,4-dihydro-2H-1-benzopyran-3,5,7-triol → {6-[2-(3,4-dihydroxyphenyl)-3,5,7-trihydroxy-4-[3,5,7-trihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-8-yl]-3,4-dihydro-2H-1-benzopyran-6-yl]-4,5-dihydroxy-2-(hydroxymethyl)oxan-3-yl}oxidanesulfonic acid details
2-(3,4-dihydroxyphenyl)-4-[3,5,7-trihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-8-yl]-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-3,4-dihydro-2H-1-benzopyran-3,5,7-triol → {2-[2-(3,4-dihydroxyphenyl)-3,5,7-trihydroxy-4-[3,5,7-trihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-8-yl]-3,4-dihydro-2H-1-benzopyran-6-yl]-3,5-dihydroxy-6-(hydroxymethyl)oxan-4-yl}oxidanesulfonic acid details
2-(3,4-dihydroxyphenyl)-4-[3,5,7-trihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-8-yl]-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-3,4-dihydro-2H-1-benzopyran-3,5,7-triol → {2-[2-(3,4-dihydroxyphenyl)-3,5,7-trihydroxy-4-[3,5,7-trihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-8-yl]-3,4-dihydro-2H-1-benzopyran-6-yl]-4,5-dihydroxy-6-(hydroxymethyl)oxan-3-yl}oxidanesulfonic acid details
2-(3-hydroxyphenyl)-4-[3,5,7-trihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-8-yl]-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-3,4-dihydro-2H-1-benzopyran-3,5,7-triol → ({3,4,5-trihydroxy-6-[3,5,7-trihydroxy-2-(3-hydroxyphenyl)-4-[3,5,7-trihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-8-yl]-3,4-dihydro-2H-1-benzopyran-6-yl]oxan-2-yl}methoxy)sulfonic acid details
2-(3-hydroxyphenyl)-4-[3,5,7-trihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-8-yl]-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-3,4-dihydro-2H-1-benzopyran-3,5,7-triol → [5,7-dihydroxy-2-(3-hydroxyphenyl)-4-[3,5,7-trihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-8-yl]-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-3,4-dihydro-2H-1-benzopyran-3-yl]oxidanesulfonic acid details
2-(3-hydroxyphenyl)-4-[3,5,7-trihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-8-yl]-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-3,4-dihydro-2H-1-benzopyran-3,5,7-triol → [4,5-dihydroxy-2-(hydroxymethyl)-6-[3,5,7-trihydroxy-2-(3-hydroxyphenyl)-4-[3,5,7-trihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-8-yl]-3,4-dihydro-2H-1-benzopyran-6-yl]oxan-3-yl]oxidanesulfonic acid details
2-(3-hydroxyphenyl)-4-[3,5,7-trihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-8-yl]-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-3,4-dihydro-2H-1-benzopyran-3,5,7-triol → [3,5-dihydroxy-2-(hydroxymethyl)-6-[3,5,7-trihydroxy-2-(3-hydroxyphenyl)-4-[3,5,7-trihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-8-yl]-3,4-dihydro-2H-1-benzopyran-6-yl]oxan-4-yl]oxidanesulfonic acid details
2-(3-hydroxyphenyl)-4-[3,5,7-trihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-8-yl]-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-3,4-dihydro-2H-1-benzopyran-3,5,7-triol → [4,5-dihydroxy-6-(hydroxymethyl)-2-[3,5,7-trihydroxy-2-(3-hydroxyphenyl)-4-[3,5,7-trihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-8-yl]-3,4-dihydro-2H-1-benzopyran-6-yl]oxan-3-yl]oxidanesulfonic acid details
4-[2-(3,4-dihydroxyphenyl)-3,5,7-trihydroxy-3,4-dihydro-2H-1-benzopyran-8-yl]-2-(3-hydroxyphenyl)-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-3,4-dihydro-2H-1-benzopyran-3,5,7-triol → [(6-{4-[2-(3,4-dihydroxyphenyl)-3,5,7-trihydroxy-3,4-dihydro-2H-1-benzopyran-8-yl]-3,5,7-trihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-8-yl}-3,4,5-trihydroxyoxan-2-yl)methoxy]sulfonic acid details
4-[2-(3,4-dihydroxyphenyl)-3,5,7-trihydroxy-3,4-dihydro-2H-1-benzopyran-8-yl]-2-(3-hydroxyphenyl)-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-3,4-dihydro-2H-1-benzopyran-3,5,7-triol → {4-[2-(3,4-dihydroxyphenyl)-3,5,7-trihydroxy-3,4-dihydro-2H-1-benzopyran-8-yl]-5,7-dihydroxy-2-(3-hydroxyphenyl)-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-3,4-dihydro-2H-1-benzopyran-3-yl}oxidanesulfonic acid details
4-[2-(3,4-dihydroxyphenyl)-3,5,7-trihydroxy-3,4-dihydro-2H-1-benzopyran-8-yl]-2-(3-hydroxyphenyl)-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-3,4-dihydro-2H-1-benzopyran-3,5,7-triol → (6-{4-[2-(3,4-dihydroxyphenyl)-3,5,7-trihydroxy-3,4-dihydro-2H-1-benzopyran-8-yl]-3,5,7-trihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-8-yl}-4,5-dihydroxy-2-(hydroxymethyl)oxan-3-yl)oxidanesulfonic acid details
4-[2-(3,4-dihydroxyphenyl)-3,5,7-trihydroxy-3,4-dihydro-2H-1-benzopyran-8-yl]-2-(3-hydroxyphenyl)-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-3,4-dihydro-2H-1-benzopyran-3,5,7-triol → (2-{4-[2-(3,4-dihydroxyphenyl)-3,5,7-trihydroxy-3,4-dihydro-2H-1-benzopyran-8-yl]-3,5,7-trihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-8-yl}-3,5-dihydroxy-6-(hydroxymethyl)oxan-4-yl)oxidanesulfonic acid details
4-[2-(3,4-dihydroxyphenyl)-3,5,7-trihydroxy-3,4-dihydro-2H-1-benzopyran-8-yl]-2-(3-hydroxyphenyl)-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-3,4-dihydro-2H-1-benzopyran-3,5,7-triol → (2-{4-[2-(3,4-dihydroxyphenyl)-3,5,7-trihydroxy-3,4-dihydro-2H-1-benzopyran-8-yl]-3,5,7-trihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-8-yl}-4,5-dihydroxy-6-(hydroxymethyl)oxan-3-yl)oxidanesulfonic acid details
2-(3,4-dihydroxyphenyl)-4-[3,5,7-trihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-8-yl]-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-3,4-dihydro-2H-1-benzopyran-3,5,7-triol → ({6-[2-(3,4-dihydroxyphenyl)-3,5,7-trihydroxy-4-[3,5,7-trihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-8-yl]-3,4-dihydro-2H-1-benzopyran-8-yl]-3,4,5-trihydroxyoxan-2-yl}methoxy)sulfonic acid details
2-(3,4-dihydroxyphenyl)-4-[3,5,7-trihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-8-yl]-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-3,4-dihydro-2H-1-benzopyran-3,5,7-triol → [2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-4-[3,5,7-trihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-8-yl]-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-3,4-dihydro-2H-1-benzopyran-3-yl]oxidanesulfonic acid details
2-(3,4-dihydroxyphenyl)-4-[3,5,7-trihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-8-yl]-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-3,4-dihydro-2H-1-benzopyran-3,5,7-triol → {6-[2-(3,4-dihydroxyphenyl)-3,5,7-trihydroxy-4-[3,5,7-trihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-8-yl]-3,4-dihydro-2H-1-benzopyran-8-yl]-4,5-dihydroxy-2-(hydroxymethyl)oxan-3-yl}oxidanesulfonic acid details
2-(3,4-dihydroxyphenyl)-4-[3,5,7-trihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-8-yl]-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-3,4-dihydro-2H-1-benzopyran-3,5,7-triol → {2-[2-(3,4-dihydroxyphenyl)-3,5,7-trihydroxy-4-[3,5,7-trihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-8-yl]-3,4-dihydro-2H-1-benzopyran-8-yl]-3,5-dihydroxy-6-(hydroxymethyl)oxan-4-yl}oxidanesulfonic acid details
2-(3,4-dihydroxyphenyl)-4-[3,5,7-trihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-8-yl]-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-3,4-dihydro-2H-1-benzopyran-3,5,7-triol → {2-[2-(3,4-dihydroxyphenyl)-3,5,7-trihydroxy-4-[3,5,7-trihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-8-yl]-3,4-dihydro-2H-1-benzopyran-8-yl]-4,5-dihydroxy-6-(hydroxymethyl)oxan-3-yl}oxidanesulfonic acid details
2-(3-hydroxyphenyl)-4-[3,5,7-trihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-8-yl]-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-3,4-dihydro-2H-1-benzopyran-3,5,7-triol → ({3,4,5-trihydroxy-6-[3,5,7-trihydroxy-2-(3-hydroxyphenyl)-4-[3,5,7-trihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-8-yl]-3,4-dihydro-2H-1-benzopyran-8-yl]oxan-2-yl}methoxy)sulfonic acid details
2-(3-hydroxyphenyl)-4-[3,5,7-trihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-8-yl]-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-3,4-dihydro-2H-1-benzopyran-3,5,7-triol → [5,7-dihydroxy-2-(3-hydroxyphenyl)-4-[3,5,7-trihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-8-yl]-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-3,4-dihydro-2H-1-benzopyran-3-yl]oxidanesulfonic acid details
2-(3-hydroxyphenyl)-4-[3,5,7-trihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-8-yl]-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-3,4-dihydro-2H-1-benzopyran-3,5,7-triol → [4,5-dihydroxy-2-(hydroxymethyl)-6-[3,5,7-trihydroxy-2-(3-hydroxyphenyl)-4-[3,5,7-trihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-8-yl]-3,4-dihydro-2H-1-benzopyran-8-yl]oxan-3-yl]oxidanesulfonic acid details
2-(3-hydroxyphenyl)-4-[3,5,7-trihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-8-yl]-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-3,4-dihydro-2H-1-benzopyran-3,5,7-triol → [3,5-dihydroxy-2-(hydroxymethyl)-6-[3,5,7-trihydroxy-2-(3-hydroxyphenyl)-4-[3,5,7-trihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-8-yl]-3,4-dihydro-2H-1-benzopyran-8-yl]oxan-4-yl]oxidanesulfonic acid details
2-(3-hydroxyphenyl)-4-[3,5,7-trihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-8-yl]-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-3,4-dihydro-2H-1-benzopyran-3,5,7-triol → [4,5-dihydroxy-6-(hydroxymethyl)-2-[3,5,7-trihydroxy-2-(3-hydroxyphenyl)-4-[3,5,7-trihydroxy-2-(3-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-8-yl]-3,4-dihydro-2H-1-benzopyran-8-yl]oxan-3-yl]oxidanesulfonic acid details
(2R)-6,8-Diglucopyranosyl-4',5,7-trihydroxyflavanone → ({6-[5,7-dihydroxy-2-(4-hydroxyphenyl)-4-oxo-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-3,4-dihydro-2H-1-benzopyran-8-yl]-3,4,5-trihydroxyoxan-2-yl}methoxy)sulfonic acid details
(2R)-6,8-Diglucopyranosyl-4',5,7-trihydroxyflavanone → ({6-[5,7-dihydroxy-2-(4-hydroxyphenyl)-4-oxo-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-3,4-dihydro-2H-1-benzopyran-6-yl]-3,4,5-trihydroxyoxan-2-yl}methoxy)sulfonic acid details
(2R)-6,8-Diglucopyranosyl-4',5,7-trihydroxyflavanone → {2-[5,7-dihydroxy-2-(4-hydroxyphenyl)-4-oxo-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-3,4-dihydro-2H-1-benzopyran-8-yl]-4,5-dihydroxy-6-(hydroxymethyl)oxan-3-yl}oxidanesulfonic acid details
(2R)-6,8-Diglucopyranosyl-4',5,7-trihydroxyflavanone → {2-[5,7-dihydroxy-2-(4-hydroxyphenyl)-4-oxo-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-3,4-dihydro-2H-1-benzopyran-8-yl]-3,5-dihydroxy-6-(hydroxymethyl)oxan-4-yl}oxidanesulfonic acid details
(2R)-6,8-Diglucopyranosyl-4',5,7-trihydroxyflavanone → {6-[5,7-dihydroxy-2-(4-hydroxyphenyl)-4-oxo-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-3,4-dihydro-2H-1-benzopyran-8-yl]-4,5-dihydroxy-2-(hydroxymethyl)oxan-3-yl}oxidanesulfonic acid details
(2R)-6,8-Diglucopyranosyl-4',5,7-trihydroxyflavanone → {6-[5,7-dihydroxy-2-(4-hydroxyphenyl)-4-oxo-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-3,4-dihydro-2H-1-benzopyran-6-yl]-4,5-dihydroxy-2-(hydroxymethyl)oxan-3-yl}oxidanesulfonic acid details
(2R)-6,8-Diglucopyranosyl-4',5,7-trihydroxyflavanone → {2-[5,7-dihydroxy-2-(4-hydroxyphenyl)-4-oxo-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-3,4-dihydro-2H-1-benzopyran-6-yl]-3,5-dihydroxy-6-(hydroxymethyl)oxan-4-yl}oxidanesulfonic acid details
(2R)-6,8-Diglucopyranosyl-4',5,7-trihydroxyflavanone → {2-[5,7-dihydroxy-2-(4-hydroxyphenyl)-4-oxo-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-3,4-dihydro-2H-1-benzopyran-6-yl]-4,5-dihydroxy-6-(hydroxymethyl)oxan-3-yl}oxidanesulfonic acid details
5,7-dihydroxy-2-phenyl-6,8-bis[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-3,4-dihydro-2H-1-benzopyran-4-one → [(6-{5,7-dihydroxy-4-oxo-2-phenyl-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-3,4-dihydro-2H-1-benzopyran-8-yl}-3,4,5-trihydroxyoxan-2-yl)methoxy]sulfonic acid details
5,7-dihydroxy-2-phenyl-6,8-bis[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-3,4-dihydro-2H-1-benzopyran-4-one → [(6-{5,7-dihydroxy-4-oxo-2-phenyl-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-3,4-dihydro-2H-1-benzopyran-6-yl}-3,4,5-trihydroxyoxan-2-yl)methoxy]sulfonic acid details
5,7-dihydroxy-2-phenyl-6,8-bis[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-3,4-dihydro-2H-1-benzopyran-4-one → (2-{5,7-dihydroxy-4-oxo-2-phenyl-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-3,4-dihydro-2H-1-benzopyran-8-yl}-4,5-dihydroxy-6-(hydroxymethyl)oxan-3-yl)oxidanesulfonic acid details
5,7-dihydroxy-2-phenyl-6,8-bis[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-3,4-dihydro-2H-1-benzopyran-4-one → (2-{5,7-dihydroxy-4-oxo-2-phenyl-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-3,4-dihydro-2H-1-benzopyran-8-yl}-3,5-dihydroxy-6-(hydroxymethyl)oxan-4-yl)oxidanesulfonic acid details
5,7-dihydroxy-2-phenyl-6,8-bis[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-3,4-dihydro-2H-1-benzopyran-4-one → (6-{5,7-dihydroxy-4-oxo-2-phenyl-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-3,4-dihydro-2H-1-benzopyran-8-yl}-4,5-dihydroxy-2-(hydroxymethyl)oxan-3-yl)oxidanesulfonic acid details
5,7-dihydroxy-2-phenyl-6,8-bis[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-3,4-dihydro-2H-1-benzopyran-4-one → (6-{5,7-dihydroxy-4-oxo-2-phenyl-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-3,4-dihydro-2H-1-benzopyran-6-yl}-4,5-dihydroxy-2-(hydroxymethyl)oxan-3-yl)oxidanesulfonic acid details
5,7-dihydroxy-2-phenyl-6,8-bis[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-3,4-dihydro-2H-1-benzopyran-4-one → (2-{5,7-dihydroxy-4-oxo-2-phenyl-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-3,4-dihydro-2H-1-benzopyran-6-yl}-3,5-dihydroxy-6-(hydroxymethyl)oxan-4-yl)oxidanesulfonic acid details
5,7-dihydroxy-2-phenyl-6,8-bis[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-3,4-dihydro-2H-1-benzopyran-4-one → (2-{5,7-dihydroxy-4-oxo-2-phenyl-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-3,4-dihydro-2H-1-benzopyran-6-yl}-4,5-dihydroxy-6-(hydroxymethyl)oxan-3-yl)oxidanesulfonic acid details
5,7-dihydroxy-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-8-(3,4,5-trihydroxyoxan-2-yl)-2-(2,4,5-trihydroxyphenyl)-4H-chromen-4-one → ({6-[5,7-dihydroxy-4-oxo-8-(3,4,5-trihydroxyoxan-2-yl)-2-(2,4,5-trihydroxyphenyl)-4H-chromen-6-yl]-3,4,5-trihydroxyoxan-2-yl}methoxy)sulfonic acid details
5,7-dihydroxy-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-8-(3,4,5-trihydroxyoxan-2-yl)-2-(2,4,5-trihydroxyphenyl)-4H-chromen-4-one → (2-{5,7-dihydroxy-4-oxo-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-2-(2,4,5-trihydroxyphenyl)-4H-chromen-8-yl}-4,5-dihydroxyoxan-3-yl)oxidanesulfonic acid details
5,7-dihydroxy-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-8-(3,4,5-trihydroxyoxan-2-yl)-2-(2,4,5-trihydroxyphenyl)-4H-chromen-4-one → (2-{5,7-dihydroxy-4-oxo-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-2-(2,4,5-trihydroxyphenyl)-4H-chromen-8-yl}-3,5-dihydroxyoxan-4-yl)oxidanesulfonic acid details
5,7-dihydroxy-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-8-(3,4,5-trihydroxyoxan-2-yl)-2-(2,4,5-trihydroxyphenyl)-4H-chromen-4-one → (6-{5,7-dihydroxy-4-oxo-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-2-(2,4,5-trihydroxyphenyl)-4H-chromen-8-yl}-4,5-dihydroxyoxan-3-yl)oxidanesulfonic acid details
5,7-dihydroxy-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-8-(3,4,5-trihydroxyoxan-2-yl)-2-(2,4,5-trihydroxyphenyl)-4H-chromen-4-one → {6-[5,7-dihydroxy-4-oxo-8-(3,4,5-trihydroxyoxan-2-yl)-2-(2,4,5-trihydroxyphenyl)-4H-chromen-6-yl]-4,5-dihydroxy-2-(hydroxymethyl)oxan-3-yl}oxidanesulfonic acid details
5,7-dihydroxy-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-8-(3,4,5-trihydroxyoxan-2-yl)-2-(2,4,5-trihydroxyphenyl)-4H-chromen-4-one → {2-[5,7-dihydroxy-4-oxo-8-(3,4,5-trihydroxyoxan-2-yl)-2-(2,4,5-trihydroxyphenyl)-4H-chromen-6-yl]-3,5-dihydroxy-6-(hydroxymethyl)oxan-4-yl}oxidanesulfonic acid details
5,7-dihydroxy-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-8-(3,4,5-trihydroxyoxan-2-yl)-2-(2,4,5-trihydroxyphenyl)-4H-chromen-4-one → {2-[5,7-dihydroxy-4-oxo-8-(3,4,5-trihydroxyoxan-2-yl)-2-(2,4,5-trihydroxyphenyl)-4H-chromen-6-yl]-4,5-dihydroxy-6-(hydroxymethyl)oxan-3-yl}oxidanesulfonic acid details
3,8-Diglucosyldiosmetin → ({6-[5,7-dihydroxy-2-(3-hydroxy-4-methoxyphenyl)-4-oxo-3-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-8-yl]-3,4,5-trihydroxyoxan-2-yl}methoxy)sulfonic acid details
3,8-Diglucosyldiosmetin → ({6-[5,7-dihydroxy-2-(3-hydroxy-4-methoxyphenyl)-4-oxo-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-3-yl]-3,4,5-trihydroxyoxan-2-yl}methoxy)sulfonic acid details
3,8-Diglucosyldiosmetin → {2-[5,7-dihydroxy-2-(3-hydroxy-4-methoxyphenyl)-4-oxo-3-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-8-yl]-4,5-dihydroxy-6-(hydroxymethyl)oxan-3-yl}oxidanesulfonic acid details
3,8-Diglucosyldiosmetin → {2-[5,7-dihydroxy-2-(3-hydroxy-4-methoxyphenyl)-4-oxo-3-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-8-yl]-3,5-dihydroxy-6-(hydroxymethyl)oxan-4-yl}oxidanesulfonic acid details
3,8-Diglucosyldiosmetin → {6-[5,7-dihydroxy-2-(3-hydroxy-4-methoxyphenyl)-4-oxo-3-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-8-yl]-4,5-dihydroxy-2-(hydroxymethyl)oxan-3-yl}oxidanesulfonic acid details
3,8-Diglucosyldiosmetin → {2-[5,7-dihydroxy-2-(3-hydroxy-4-methoxyphenyl)-4-oxo-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-3-yl]-4,5-dihydroxy-6-(hydroxymethyl)oxan-3-yl}oxidanesulfonic acid details
3,8-Diglucosyldiosmetin → {2-[5,7-dihydroxy-2-(3-hydroxy-4-methoxyphenyl)-4-oxo-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-3-yl]-3,5-dihydroxy-6-(hydroxymethyl)oxan-4-yl}oxidanesulfonic acid details
3,8-Diglucosyldiosmetin → {6-[5,7-dihydroxy-2-(3-hydroxy-4-methoxyphenyl)-4-oxo-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-3-yl]-4,5-dihydroxy-2-(hydroxymethyl)oxan-3-yl}oxidanesulfonic acid details
6,8-Diglucosyldiosmetin → ({6-[5,7-dihydroxy-2-(3-hydroxy-4-methoxyphenyl)-4-oxo-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-8-yl]-3,4,5-trihydroxyoxan-2-yl}methoxy)sulfonic acid details
6,8-Diglucosyldiosmetin → ({6-[5,7-dihydroxy-2-(3-hydroxy-4-methoxyphenyl)-4-oxo-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-6-yl]-3,4,5-trihydroxyoxan-2-yl}methoxy)sulfonic acid details
6,8-Diglucosyldiosmetin → {2-[5,7-dihydroxy-2-(3-hydroxy-4-methoxyphenyl)-4-oxo-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-8-yl]-4,5-dihydroxy-6-(hydroxymethyl)oxan-3-yl}oxidanesulfonic acid details
6,8-Diglucosyldiosmetin → {2-[5,7-dihydroxy-2-(3-hydroxy-4-methoxyphenyl)-4-oxo-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-8-yl]-3,5-dihydroxy-6-(hydroxymethyl)oxan-4-yl}oxidanesulfonic acid details
6,8-Diglucosyldiosmetin → {6-[5,7-dihydroxy-2-(3-hydroxy-4-methoxyphenyl)-4-oxo-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-8-yl]-4,5-dihydroxy-2-(hydroxymethyl)oxan-3-yl}oxidanesulfonic acid details
6,8-Diglucosyldiosmetin → {2-[5,7-dihydroxy-2-(3-hydroxy-4-methoxyphenyl)-4-oxo-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-6-yl]-4,5-dihydroxy-6-(hydroxymethyl)oxan-3-yl}oxidanesulfonic acid details
6,8-Diglucosyldiosmetin → {2-[5,7-dihydroxy-2-(3-hydroxy-4-methoxyphenyl)-4-oxo-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-6-yl]-3,5-dihydroxy-6-(hydroxymethyl)oxan-4-yl}oxidanesulfonic acid details
6,8-Diglucosyldiosmetin → {6-[5,7-dihydroxy-2-(3-hydroxy-4-methoxyphenyl)-4-oxo-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-6-yl]-4,5-dihydroxy-2-(hydroxymethyl)oxan-3-yl}oxidanesulfonic acid details
Lucenin 2,7-O-rhamnoside → ({6-[2-(3,4-dihydroxyphenyl)-5-hydroxy-4-oxo-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-7-[(3,4,5-trihydroxy-6-methyloxan-2-yl)oxy]-4H-chromen-8-yl]-3,4,5-trihydroxyoxan-2-yl}methoxy)sulfonic acid details
Lucenin 2,7-O-rhamnoside → ({6-[2-(3,4-dihydroxyphenyl)-5-hydroxy-4-oxo-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-7-[(3,4,5-trihydroxy-6-methyloxan-2-yl)oxy]-4H-chromen-6-yl]-3,4,5-trihydroxyoxan-2-yl}methoxy)sulfonic acid details
Lucenin 2,7-O-rhamnoside → {2-[2-(3,4-dihydroxyphenyl)-5-hydroxy-4-oxo-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-7-[(3,4,5-trihydroxy-6-methyloxan-2-yl)oxy]-4H-chromen-8-yl]-4,5-dihydroxy-6-(hydroxymethyl)oxan-3-yl}oxidanesulfonic acid details
Lucenin 2,7-O-rhamnoside → {2-[2-(3,4-dihydroxyphenyl)-5-hydroxy-4-oxo-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-7-[(3,4,5-trihydroxy-6-methyloxan-2-yl)oxy]-4H-chromen-8-yl]-3,5-dihydroxy-6-(hydroxymethyl)oxan-4-yl}oxidanesulfonic acid details
Lucenin 2,7-O-rhamnoside → {6-[2-(3,4-dihydroxyphenyl)-5-hydroxy-4-oxo-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-7-[(3,4,5-trihydroxy-6-methyloxan-2-yl)oxy]-4H-chromen-8-yl]-4,5-dihydroxy-2-(hydroxymethyl)oxan-3-yl}oxidanesulfonic acid details
Lucenin 2,7-O-rhamnoside → {2-[2-(3,4-dihydroxyphenyl)-5-hydroxy-4-oxo-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-7-[(3,4,5-trihydroxy-6-methyloxan-2-yl)oxy]-4H-chromen-6-yl]-4,5-dihydroxy-6-(hydroxymethyl)oxan-3-yl}oxidanesulfonic acid details
Lucenin 2,7-O-rhamnoside → {2-[2-(3,4-dihydroxyphenyl)-5-hydroxy-4-oxo-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-7-[(3,4,5-trihydroxy-6-methyloxan-2-yl)oxy]-4H-chromen-6-yl]-3,5-dihydroxy-6-(hydroxymethyl)oxan-4-yl}oxidanesulfonic acid details
Lucenin 2,7-O-rhamnoside → {6-[2-(3,4-dihydroxyphenyl)-5-hydroxy-4-oxo-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-7-[(3,4,5-trihydroxy-6-methyloxan-2-yl)oxy]-4H-chromen-6-yl]-4,5-dihydroxy-2-(hydroxymethyl)oxan-3-yl}oxidanesulfonic acid details
5,7-dihydroxy-6,8-bis[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-2-(2,4,5-trihydroxyphenyl)-4H-chromen-4-one → [(6-{5,7-dihydroxy-4-oxo-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-2-(2,4,5-trihydroxyphenyl)-4H-chromen-8-yl}-3,4,5-trihydroxyoxan-2-yl)methoxy]sulfonic acid details
5,7-dihydroxy-6,8-bis[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-2-(2,4,5-trihydroxyphenyl)-4H-chromen-4-one → [(6-{5,7-dihydroxy-4-oxo-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-2-(2,4,5-trihydroxyphenyl)-4H-chromen-6-yl}-3,4,5-trihydroxyoxan-2-yl)methoxy]sulfonic acid details
5,7-dihydroxy-6,8-bis[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-2-(2,4,5-trihydroxyphenyl)-4H-chromen-4-one → (2-{5,7-dihydroxy-4-oxo-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-2-(2,4,5-trihydroxyphenyl)-4H-chromen-8-yl}-4,5-dihydroxy-6-(hydroxymethyl)oxan-3-yl)oxidanesulfonic acid details
5,7-dihydroxy-6,8-bis[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-2-(2,4,5-trihydroxyphenyl)-4H-chromen-4-one → (2-{5,7-dihydroxy-4-oxo-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-2-(2,4,5-trihydroxyphenyl)-4H-chromen-8-yl}-3,5-dihydroxy-6-(hydroxymethyl)oxan-4-yl)oxidanesulfonic acid details
5,7-dihydroxy-6,8-bis[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-2-(2,4,5-trihydroxyphenyl)-4H-chromen-4-one → (6-{5,7-dihydroxy-4-oxo-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-2-(2,4,5-trihydroxyphenyl)-4H-chromen-8-yl}-4,5-dihydroxy-2-(hydroxymethyl)oxan-3-yl)oxidanesulfonic acid details
5,7-dihydroxy-6,8-bis[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-2-(2,4,5-trihydroxyphenyl)-4H-chromen-4-one → (2-{5,7-dihydroxy-4-oxo-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-2-(2,4,5-trihydroxyphenyl)-4H-chromen-6-yl}-4,5-dihydroxy-6-(hydroxymethyl)oxan-3-yl)oxidanesulfonic acid details
5,7-dihydroxy-6,8-bis[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-2-(2,4,5-trihydroxyphenyl)-4H-chromen-4-one → (2-{5,7-dihydroxy-4-oxo-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-2-(2,4,5-trihydroxyphenyl)-4H-chromen-6-yl}-3,5-dihydroxy-6-(hydroxymethyl)oxan-4-yl)oxidanesulfonic acid details
5,7-dihydroxy-6,8-bis[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-2-(2,4,5-trihydroxyphenyl)-4H-chromen-4-one → (6-{5,7-dihydroxy-4-oxo-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-2-(2,4,5-trihydroxyphenyl)-4H-chromen-6-yl}-4,5-dihydroxy-2-(hydroxymethyl)oxan-3-yl)oxidanesulfonic acid details
3,6-Diglucopyranosyl-4',5,7-trihydroxyflavone → ({6-[5,7-dihydroxy-2-(4-hydroxyphenyl)-4-oxo-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-3-yl]-3,4,5-trihydroxyoxan-2-yl}methoxy)sulfonic acid details
3,6-Diglucopyranosyl-4',5,7-trihydroxyflavone → ({6-[5,7-dihydroxy-2-(4-hydroxyphenyl)-4-oxo-3-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-6-yl]-3,4,5-trihydroxyoxan-2-yl}methoxy)sulfonic acid details
3,6-Diglucopyranosyl-4',5,7-trihydroxyflavone → {2-[5,7-dihydroxy-2-(4-hydroxyphenyl)-4-oxo-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-3-yl]-4,5-dihydroxy-6-(hydroxymethyl)oxan-3-yl}oxidanesulfonic acid details
3,6-Diglucopyranosyl-4',5,7-trihydroxyflavone → {2-[5,7-dihydroxy-2-(4-hydroxyphenyl)-4-oxo-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-3-yl]-3,5-dihydroxy-6-(hydroxymethyl)oxan-4-yl}oxidanesulfonic acid details
3,6-Diglucopyranosyl-4',5,7-trihydroxyflavone → {6-[5,7-dihydroxy-2-(4-hydroxyphenyl)-4-oxo-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-3-yl]-4,5-dihydroxy-2-(hydroxymethyl)oxan-3-yl}oxidanesulfonic acid details
3,6-Diglucopyranosyl-4',5,7-trihydroxyflavone → {6-[5,7-dihydroxy-2-(4-hydroxyphenyl)-4-oxo-3-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-6-yl]-4,5-dihydroxy-2-(hydroxymethyl)oxan-3-yl}oxidanesulfonic acid details
3,6-Diglucopyranosyl-4',5,7-trihydroxyflavone → {2-[5,7-dihydroxy-2-(4-hydroxyphenyl)-4-oxo-3-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-6-yl]-3,5-dihydroxy-6-(hydroxymethyl)oxan-4-yl}oxidanesulfonic acid details
3,6-Diglucopyranosyl-4',5,7-trihydroxyflavone → {2-[5,7-dihydroxy-2-(4-hydroxyphenyl)-4-oxo-3-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-6-yl]-4,5-dihydroxy-6-(hydroxymethyl)oxan-3-yl}oxidanesulfonic acid details
2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-3,6-bis[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → ({6-[2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-4-oxo-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-3-yl]-3,4,5-trihydroxyoxan-2-yl}methoxy)sulfonic acid details
2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-3,6-bis[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → ({6-[2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-4-oxo-3-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-6-yl]-3,4,5-trihydroxyoxan-2-yl}methoxy)sulfonic acid details
2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-3,6-bis[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → {2-[2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-4-oxo-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-3-yl]-4,5-dihydroxy-6-(hydroxymethyl)oxan-3-yl}oxidanesulfonic acid details
2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-3,6-bis[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → {2-[2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-4-oxo-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-3-yl]-3,5-dihydroxy-6-(hydroxymethyl)oxan-4-yl}oxidanesulfonic acid details
2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-3,6-bis[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → {6-[2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-4-oxo-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-3-yl]-4,5-dihydroxy-2-(hydroxymethyl)oxan-3-yl}oxidanesulfonic acid details
2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-3,6-bis[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → {6-[2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-4-oxo-3-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-6-yl]-4,5-dihydroxy-2-(hydroxymethyl)oxan-3-yl}oxidanesulfonic acid details
2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-3,6-bis[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → {2-[2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-4-oxo-3-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-6-yl]-3,5-dihydroxy-6-(hydroxymethyl)oxan-4-yl}oxidanesulfonic acid details
2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-3,6-bis[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → {2-[2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-4-oxo-3-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-6-yl]-4,5-dihydroxy-6-(hydroxymethyl)oxan-3-yl}oxidanesulfonic acid details
5,7-dihydroxy-2-phenyl-3,6-bis[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → [(6-{5,7-dihydroxy-4-oxo-2-phenyl-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-3-yl}-3,4,5-trihydroxyoxan-2-yl)methoxy]sulfonic acid details
5,7-dihydroxy-2-phenyl-3,6-bis[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → [(6-{5,7-dihydroxy-4-oxo-2-phenyl-3-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-6-yl}-3,4,5-trihydroxyoxan-2-yl)methoxy]sulfonic acid details
5,7-dihydroxy-2-phenyl-3,6-bis[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → (2-{5,7-dihydroxy-4-oxo-2-phenyl-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-3-yl}-4,5-dihydroxy-6-(hydroxymethyl)oxan-3-yl)oxidanesulfonic acid details
5,7-dihydroxy-2-phenyl-3,6-bis[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → (2-{5,7-dihydroxy-4-oxo-2-phenyl-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-3-yl}-3,5-dihydroxy-6-(hydroxymethyl)oxan-4-yl)oxidanesulfonic acid details
5,7-dihydroxy-2-phenyl-3,6-bis[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → (6-{5,7-dihydroxy-4-oxo-2-phenyl-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-3-yl}-4,5-dihydroxy-2-(hydroxymethyl)oxan-3-yl)oxidanesulfonic acid details
5,7-dihydroxy-2-phenyl-3,6-bis[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → (6-{5,7-dihydroxy-4-oxo-2-phenyl-3-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-6-yl}-4,5-dihydroxy-2-(hydroxymethyl)oxan-3-yl)oxidanesulfonic acid details
5,7-dihydroxy-2-phenyl-3,6-bis[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → (2-{5,7-dihydroxy-4-oxo-2-phenyl-3-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-6-yl}-3,5-dihydroxy-6-(hydroxymethyl)oxan-4-yl)oxidanesulfonic acid details
5,7-dihydroxy-2-phenyl-3,6-bis[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → (2-{5,7-dihydroxy-4-oxo-2-phenyl-3-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-6-yl}-4,5-dihydroxy-6-(hydroxymethyl)oxan-3-yl)oxidanesulfonic acid details
5,7-dihydroxy-2-(3-hydroxyphenyl)-3,6-bis[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → ({6-[5,7-dihydroxy-2-(3-hydroxyphenyl)-4-oxo-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-3-yl]-3,4,5-trihydroxyoxan-2-yl}methoxy)sulfonic acid details
5,7-dihydroxy-2-(3-hydroxyphenyl)-3,6-bis[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → ({6-[5,7-dihydroxy-2-(3-hydroxyphenyl)-4-oxo-3-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-6-yl]-3,4,5-trihydroxyoxan-2-yl}methoxy)sulfonic acid details
5,7-dihydroxy-2-(3-hydroxyphenyl)-3,6-bis[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → {2-[5,7-dihydroxy-2-(3-hydroxyphenyl)-4-oxo-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-3-yl]-4,5-dihydroxy-6-(hydroxymethyl)oxan-3-yl}oxidanesulfonic acid details
5,7-dihydroxy-2-(3-hydroxyphenyl)-3,6-bis[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → {2-[5,7-dihydroxy-2-(3-hydroxyphenyl)-4-oxo-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-3-yl]-3,5-dihydroxy-6-(hydroxymethyl)oxan-4-yl}oxidanesulfonic acid details
5,7-dihydroxy-2-(3-hydroxyphenyl)-3,6-bis[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → {6-[5,7-dihydroxy-2-(3-hydroxyphenyl)-4-oxo-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-3-yl]-4,5-dihydroxy-2-(hydroxymethyl)oxan-3-yl}oxidanesulfonic acid details
5,7-dihydroxy-2-(3-hydroxyphenyl)-3,6-bis[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → {6-[5,7-dihydroxy-2-(3-hydroxyphenyl)-4-oxo-3-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-6-yl]-4,5-dihydroxy-2-(hydroxymethyl)oxan-3-yl}oxidanesulfonic acid details
5,7-dihydroxy-2-(3-hydroxyphenyl)-3,6-bis[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → {2-[5,7-dihydroxy-2-(3-hydroxyphenyl)-4-oxo-3-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-6-yl]-3,5-dihydroxy-6-(hydroxymethyl)oxan-4-yl}oxidanesulfonic acid details
5,7-dihydroxy-2-(3-hydroxyphenyl)-3,6-bis[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → {2-[5,7-dihydroxy-2-(3-hydroxyphenyl)-4-oxo-3-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-6-yl]-4,5-dihydroxy-6-(hydroxymethyl)oxan-3-yl}oxidanesulfonic acid details
3,6-Diglucopyranosyl-5,7-dihydroxy-4'-methoxyflavone → ({6-[5,7-dihydroxy-2-(4-methoxyphenyl)-4-oxo-3-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-6-yl]-3,4,5-trihydroxyoxan-2-yl}methoxy)sulfonic acid details
3,6-Diglucopyranosyl-5,7-dihydroxy-4'-methoxyflavone → ({6-[5,7-dihydroxy-2-(4-methoxyphenyl)-4-oxo-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-3-yl]-3,4,5-trihydroxyoxan-2-yl}methoxy)sulfonic acid details
3,6-Diglucopyranosyl-5,7-dihydroxy-4'-methoxyflavone → {2-[5,7-dihydroxy-2-(4-methoxyphenyl)-4-oxo-3-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-6-yl]-4,5-dihydroxy-6-(hydroxymethyl)oxan-3-yl}oxidanesulfonic acid details
3,6-Diglucopyranosyl-5,7-dihydroxy-4'-methoxyflavone → {2-[5,7-dihydroxy-2-(4-methoxyphenyl)-4-oxo-3-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-6-yl]-3,5-dihydroxy-6-(hydroxymethyl)oxan-4-yl}oxidanesulfonic acid details
3,6-Diglucopyranosyl-5,7-dihydroxy-4'-methoxyflavone → {6-[5,7-dihydroxy-2-(4-methoxyphenyl)-4-oxo-3-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-6-yl]-4,5-dihydroxy-2-(hydroxymethyl)oxan-3-yl}oxidanesulfonic acid details
3,6-Diglucopyranosyl-5,7-dihydroxy-4'-methoxyflavone → {2-[5,7-dihydroxy-2-(4-methoxyphenyl)-4-oxo-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-3-yl]-4,5-dihydroxy-6-(hydroxymethyl)oxan-3-yl}oxidanesulfonic acid details
3,6-Diglucopyranosyl-5,7-dihydroxy-4'-methoxyflavone → {2-[5,7-dihydroxy-2-(4-methoxyphenyl)-4-oxo-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-3-yl]-3,5-dihydroxy-6-(hydroxymethyl)oxan-4-yl}oxidanesulfonic acid details
3,6-Diglucopyranosyl-5,7-dihydroxy-4'-methoxyflavone → {6-[5,7-dihydroxy-2-(4-methoxyphenyl)-4-oxo-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-3-yl]-4,5-dihydroxy-2-(hydroxymethyl)oxan-3-yl}oxidanesulfonic acid details
5-hydroxy-7-methoxy-2-phenyl-6,8-bis[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → [(3,4,5-trihydroxy-6-{5-hydroxy-7-methoxy-4-oxo-2-phenyl-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-6-yl}oxan-2-yl)methoxy]sulfonic acid details
5-hydroxy-7-methoxy-2-phenyl-6,8-bis[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → [(3,4,5-trihydroxy-6-{5-hydroxy-7-methoxy-4-oxo-2-phenyl-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-8-yl}oxan-2-yl)methoxy]sulfonic acid details
5-hydroxy-7-methoxy-2-phenyl-6,8-bis[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → (4,5-dihydroxy-2-{5-hydroxy-7-methoxy-4-oxo-2-phenyl-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-6-yl}-6-(hydroxymethyl)oxan-3-yl)oxidanesulfonic acid details
5-hydroxy-7-methoxy-2-phenyl-6,8-bis[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → (3,5-dihydroxy-2-{5-hydroxy-7-methoxy-4-oxo-2-phenyl-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-6-yl}-6-(hydroxymethyl)oxan-4-yl)oxidanesulfonic acid details
5-hydroxy-7-methoxy-2-phenyl-6,8-bis[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → (4,5-dihydroxy-6-{5-hydroxy-7-methoxy-4-oxo-2-phenyl-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-6-yl}-2-(hydroxymethyl)oxan-3-yl)oxidanesulfonic acid details
5-hydroxy-7-methoxy-2-phenyl-6,8-bis[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → (4,5-dihydroxy-2-{5-hydroxy-7-methoxy-4-oxo-2-phenyl-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-8-yl}-6-(hydroxymethyl)oxan-3-yl)oxidanesulfonic acid details
5-hydroxy-7-methoxy-2-phenyl-6,8-bis[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → (3,5-dihydroxy-2-{5-hydroxy-7-methoxy-4-oxo-2-phenyl-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-8-yl}-6-(hydroxymethyl)oxan-4-yl)oxidanesulfonic acid details
5-hydroxy-7-methoxy-2-phenyl-6,8-bis[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → (4,5-dihydroxy-6-{5-hydroxy-7-methoxy-4-oxo-2-phenyl-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-8-yl}-2-(hydroxymethyl)oxan-3-yl)oxidanesulfonic acid details
5,7-dihydroxy-2-(4-methoxyphenyl)-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → ({6-[5,7-dihydroxy-2-(4-methoxyphenyl)-4-oxo-4H-chromen-6-yl]-3,4,5-trihydroxyoxan-2-yl}methoxy)sulfonic acid details
5,7-dihydroxy-2-(4-methoxyphenyl)-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → {2-[5,7-dihydroxy-2-(4-methoxyphenyl)-4-oxo-4H-chromen-6-yl]-4,5-dihydroxy-6-(hydroxymethyl)oxan-3-yl}oxidanesulfonic acid details
5,7-dihydroxy-2-(4-methoxyphenyl)-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → {2-[5,7-dihydroxy-2-(4-methoxyphenyl)-4-oxo-4H-chromen-6-yl]-3,5-dihydroxy-6-(hydroxymethyl)oxan-4-yl}oxidanesulfonic acid details
5,7-dihydroxy-2-(4-methoxyphenyl)-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → {6-[5,7-dihydroxy-2-(4-methoxyphenyl)-4-oxo-4H-chromen-6-yl]-4,5-dihydroxy-2-(hydroxymethyl)oxan-3-yl}oxidanesulfonic acid details
5,7-dihydroxy-2-(4-hydroxyphenyl)-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → ({6-[5,7-dihydroxy-2-(4-hydroxyphenyl)-4-oxo-4H-chromen-6-yl]-3,4,5-trihydroxyoxan-2-yl}methoxy)sulfonic acid details
5,7-dihydroxy-2-(4-hydroxyphenyl)-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → {2-[5,7-dihydroxy-2-(4-hydroxyphenyl)-4-oxo-4H-chromen-6-yl]-4,5-dihydroxy-6-(hydroxymethyl)oxan-3-yl}oxidanesulfonic acid details
5,7-dihydroxy-2-(4-hydroxyphenyl)-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → {2-[5,7-dihydroxy-2-(4-hydroxyphenyl)-4-oxo-4H-chromen-6-yl]-3,5-dihydroxy-6-(hydroxymethyl)oxan-4-yl}oxidanesulfonic acid details
5,7-dihydroxy-2-(4-hydroxyphenyl)-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → {6-[5,7-dihydroxy-2-(4-hydroxyphenyl)-4-oxo-4H-chromen-6-yl]-4,5-dihydroxy-2-(hydroxymethyl)oxan-3-yl}oxidanesulfonic acid details
5,7-dihydroxy-2-phenyl-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → {[6-(5,7-dihydroxy-4-oxo-2-phenyl-4H-chromen-6-yl)-3,4,5-trihydroxyoxan-2-yl]methoxy}sulfonic acid details
5,7-dihydroxy-2-phenyl-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → [2-(5,7-dihydroxy-4-oxo-2-phenyl-4H-chromen-6-yl)-4,5-dihydroxy-6-(hydroxymethyl)oxan-3-yl]oxidanesulfonic acid details
5,7-dihydroxy-2-phenyl-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → [2-(5,7-dihydroxy-4-oxo-2-phenyl-4H-chromen-6-yl)-3,5-dihydroxy-6-(hydroxymethyl)oxan-4-yl]oxidanesulfonic acid details
5,7-dihydroxy-2-phenyl-6-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → [6-(5,7-dihydroxy-4-oxo-2-phenyl-4H-chromen-6-yl)-4,5-dihydroxy-2-(hydroxymethyl)oxan-3-yl]oxidanesulfonic acid details
5-hydroxy-2-(4-hydroxyphenyl)-7-methoxy-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → ({3,4,5-trihydroxy-6-[5-hydroxy-2-(4-hydroxyphenyl)-7-methoxy-4-oxo-4H-chromen-8-yl]oxan-2-yl}methoxy)sulfonic acid details
5-hydroxy-2-(4-hydroxyphenyl)-7-methoxy-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → {4,5-dihydroxy-2-[5-hydroxy-2-(4-hydroxyphenyl)-7-methoxy-4-oxo-4H-chromen-8-yl]-6-(hydroxymethyl)oxan-3-yl}oxidanesulfonic acid details
5-hydroxy-2-(4-hydroxyphenyl)-7-methoxy-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → {3,5-dihydroxy-2-[5-hydroxy-2-(4-hydroxyphenyl)-7-methoxy-4-oxo-4H-chromen-8-yl]-6-(hydroxymethyl)oxan-4-yl}oxidanesulfonic acid details
5-hydroxy-2-(4-hydroxyphenyl)-7-methoxy-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → {4,5-dihydroxy-6-[5-hydroxy-2-(4-hydroxyphenyl)-7-methoxy-4-oxo-4H-chromen-8-yl]-2-(hydroxymethyl)oxan-3-yl}oxidanesulfonic acid details
5,6-dihydroxy-2-(4-hydroxyphenyl)-7-methoxy-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → ({6-[5,6-dihydroxy-2-(4-hydroxyphenyl)-7-methoxy-4-oxo-4H-chromen-8-yl]-3,4,5-trihydroxyoxan-2-yl}methoxy)sulfonic acid details
5,6-dihydroxy-2-(4-hydroxyphenyl)-7-methoxy-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → {2-[5,6-dihydroxy-2-(4-hydroxyphenyl)-7-methoxy-4-oxo-4H-chromen-8-yl]-4,5-dihydroxy-6-(hydroxymethyl)oxan-3-yl}oxidanesulfonic acid details
5,6-dihydroxy-2-(4-hydroxyphenyl)-7-methoxy-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → {2-[5,6-dihydroxy-2-(4-hydroxyphenyl)-7-methoxy-4-oxo-4H-chromen-8-yl]-3,5-dihydroxy-6-(hydroxymethyl)oxan-4-yl}oxidanesulfonic acid details
5,6-dihydroxy-2-(4-hydroxyphenyl)-7-methoxy-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → {6-[5,6-dihydroxy-2-(4-hydroxyphenyl)-7-methoxy-4-oxo-4H-chromen-8-yl]-4,5-dihydroxy-2-(hydroxymethyl)oxan-3-yl}oxidanesulfonic acid details
Isoswertiajaponin → ({6-[2-(3,4-dihydroxyphenyl)-5-hydroxy-7-methoxy-4-oxo-4H-chromen-8-yl]-3,4,5-trihydroxyoxan-2-yl}methoxy)sulfonic acid details
Isoswertiajaponin → {2-[2-(3,4-dihydroxyphenyl)-5-hydroxy-7-methoxy-4-oxo-4H-chromen-8-yl]-4,5-dihydroxy-6-(hydroxymethyl)oxan-3-yl}oxidanesulfonic acid details
Isoswertiajaponin → {2-[2-(3,4-dihydroxyphenyl)-5-hydroxy-7-methoxy-4-oxo-4H-chromen-8-yl]-3,5-dihydroxy-6-(hydroxymethyl)oxan-4-yl}oxidanesulfonic acid details
Isoswertiajaponin → {6-[2-(3,4-dihydroxyphenyl)-5-hydroxy-7-methoxy-4-oxo-4H-chromen-8-yl]-4,5-dihydroxy-2-(hydroxymethyl)oxan-3-yl}oxidanesulfonic acid details
5,7-dihydroxy-2-(4-hydroxyphenyl)-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → ({6-[5,7-dihydroxy-2-(4-hydroxyphenyl)-4-oxo-4H-chromen-8-yl]-3,4,5-trihydroxyoxan-2-yl}methoxy)sulfonic acid details
5,7-dihydroxy-2-(4-hydroxyphenyl)-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → {2-[5,7-dihydroxy-2-(4-hydroxyphenyl)-4-oxo-4H-chromen-8-yl]-4,5-dihydroxy-6-(hydroxymethyl)oxan-3-yl}oxidanesulfonic acid details
5,7-dihydroxy-2-(4-hydroxyphenyl)-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → {2-[5,7-dihydroxy-2-(4-hydroxyphenyl)-4-oxo-4H-chromen-8-yl]-3,5-dihydroxy-6-(hydroxymethyl)oxan-4-yl}oxidanesulfonic acid details
5,7-dihydroxy-2-(4-hydroxyphenyl)-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → {6-[5,7-dihydroxy-2-(4-hydroxyphenyl)-4-oxo-4H-chromen-8-yl]-4,5-dihydroxy-2-(hydroxymethyl)oxan-3-yl}oxidanesulfonic acid details
5-hydroxy-7-methoxy-2-phenyl-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → {[3,4,5-trihydroxy-6-(5-hydroxy-7-methoxy-4-oxo-2-phenyl-4H-chromen-8-yl)oxan-2-yl]methoxy}sulfonic acid details
5-hydroxy-7-methoxy-2-phenyl-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → [4,5-dihydroxy-2-(5-hydroxy-7-methoxy-4-oxo-2-phenyl-4H-chromen-8-yl)-6-(hydroxymethyl)oxan-3-yl]oxidanesulfonic acid details
5-hydroxy-7-methoxy-2-phenyl-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → [3,5-dihydroxy-2-(5-hydroxy-7-methoxy-4-oxo-2-phenyl-4H-chromen-8-yl)-6-(hydroxymethyl)oxan-4-yl]oxidanesulfonic acid details
5-hydroxy-7-methoxy-2-phenyl-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → [4,5-dihydroxy-6-(5-hydroxy-7-methoxy-4-oxo-2-phenyl-4H-chromen-8-yl)-2-(hydroxymethyl)oxan-3-yl]oxidanesulfonic acid details
5,7-dihydroxy-2-phenyl-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → {[6-(5,7-dihydroxy-4-oxo-2-phenyl-4H-chromen-8-yl)-3,4,5-trihydroxyoxan-2-yl]methoxy}sulfonic acid details
5,7-dihydroxy-2-phenyl-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → [2-(5,7-dihydroxy-4-oxo-2-phenyl-4H-chromen-8-yl)-4,5-dihydroxy-6-(hydroxymethyl)oxan-3-yl]oxidanesulfonic acid details
5,7-dihydroxy-2-phenyl-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → [2-(5,7-dihydroxy-4-oxo-2-phenyl-4H-chromen-8-yl)-3,5-dihydroxy-6-(hydroxymethyl)oxan-4-yl]oxidanesulfonic acid details
5,7-dihydroxy-2-phenyl-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → [6-(5,7-dihydroxy-4-oxo-2-phenyl-4H-chromen-8-yl)-4,5-dihydroxy-2-(hydroxymethyl)oxan-3-yl]oxidanesulfonic acid details
5,6,7-trihydroxy-2-(4-hydroxyphenyl)-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → ({3,4,5-trihydroxy-6-[5,6,7-trihydroxy-2-(4-hydroxyphenyl)-4-oxo-4H-chromen-8-yl]oxan-2-yl}methoxy)sulfonic acid details
5,6,7-trihydroxy-2-(4-hydroxyphenyl)-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → [4,5-dihydroxy-6-(hydroxymethyl)-2-[5,6,7-trihydroxy-2-(4-hydroxyphenyl)-4-oxo-4H-chromen-8-yl]oxan-3-yl]oxidanesulfonic acid details
5,6,7-trihydroxy-2-(4-hydroxyphenyl)-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → [3,5-dihydroxy-2-(hydroxymethyl)-6-[5,6,7-trihydroxy-2-(4-hydroxyphenyl)-4-oxo-4H-chromen-8-yl]oxan-4-yl]oxidanesulfonic acid details
5,6,7-trihydroxy-2-(4-hydroxyphenyl)-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → [4,5-dihydroxy-2-(hydroxymethyl)-6-[5,6,7-trihydroxy-2-(4-hydroxyphenyl)-4-oxo-4H-chromen-8-yl]oxan-3-yl]oxidanesulfonic acid details
5,6-dihydroxy-7-methoxy-2-phenyl-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → {[6-(5,6-dihydroxy-7-methoxy-4-oxo-2-phenyl-4H-chromen-8-yl)-3,4,5-trihydroxyoxan-2-yl]methoxy}sulfonic acid details
5,6-dihydroxy-7-methoxy-2-phenyl-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → [2-(5,6-dihydroxy-7-methoxy-4-oxo-2-phenyl-4H-chromen-8-yl)-4,5-dihydroxy-6-(hydroxymethyl)oxan-3-yl]oxidanesulfonic acid details
5,6-dihydroxy-7-methoxy-2-phenyl-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → [2-(5,6-dihydroxy-7-methoxy-4-oxo-2-phenyl-4H-chromen-8-yl)-3,5-dihydroxy-6-(hydroxymethyl)oxan-4-yl]oxidanesulfonic acid details
5,6-dihydroxy-7-methoxy-2-phenyl-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → [6-(5,6-dihydroxy-7-methoxy-4-oxo-2-phenyl-4H-chromen-8-yl)-4,5-dihydroxy-2-(hydroxymethyl)oxan-3-yl]oxidanesulfonic acid details
5,6,7-trihydroxy-2-phenyl-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → {[3,4,5-trihydroxy-6-(5,6,7-trihydroxy-4-oxo-2-phenyl-4H-chromen-8-yl)oxan-2-yl]methoxy}sulfonic acid details
5,6,7-trihydroxy-2-phenyl-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → [4,5-dihydroxy-6-(hydroxymethyl)-2-(5,6,7-trihydroxy-4-oxo-2-phenyl-4H-chromen-8-yl)oxan-3-yl]oxidanesulfonic acid details
5,6,7-trihydroxy-2-phenyl-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → [3,5-dihydroxy-2-(hydroxymethyl)-6-(5,6,7-trihydroxy-4-oxo-2-phenyl-4H-chromen-8-yl)oxan-4-yl]oxidanesulfonic acid details
5,6,7-trihydroxy-2-phenyl-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → [4,5-dihydroxy-2-(hydroxymethyl)-6-(5,6,7-trihydroxy-4-oxo-2-phenyl-4H-chromen-8-yl)oxan-3-yl]oxidanesulfonic acid details
5-hydroxy-2-(3-hydroxyphenyl)-7-methoxy-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → ({3,4,5-trihydroxy-6-[5-hydroxy-2-(3-hydroxyphenyl)-7-methoxy-4-oxo-4H-chromen-8-yl]oxan-2-yl}methoxy)sulfonic acid details
5-hydroxy-2-(3-hydroxyphenyl)-7-methoxy-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → {4,5-dihydroxy-2-[5-hydroxy-2-(3-hydroxyphenyl)-7-methoxy-4-oxo-4H-chromen-8-yl]-6-(hydroxymethyl)oxan-3-yl}oxidanesulfonic acid details
5-hydroxy-2-(3-hydroxyphenyl)-7-methoxy-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → {3,5-dihydroxy-2-[5-hydroxy-2-(3-hydroxyphenyl)-7-methoxy-4-oxo-4H-chromen-8-yl]-6-(hydroxymethyl)oxan-4-yl}oxidanesulfonic acid details
5-hydroxy-2-(3-hydroxyphenyl)-7-methoxy-8-[3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]-4H-chromen-4-one → {4,5-dihydroxy-6-[5-hydroxy-2-(3-hydroxyphenyl)-7-methoxy-4-oxo-4H-chromen-8-yl]-2-(hydroxymethyl)oxan-3-yl}oxidanesulfonic acid details
5-hydroxy-2-(4-hydroxyphenyl)-7-methoxy-8-(3,4,5-trihydroxyoxan-2-yl)-4H-chromen-4-one → {4,5-dihydroxy-2-[5-hydroxy-2-(4-hydroxyphenyl)-7-methoxy-4-oxo-4H-chromen-8-yl]oxan-3-yl}oxidanesulfonic acid details
5-hydroxy-2-(4-hydroxyphenyl)-7-methoxy-8-(3,4,5-trihydroxyoxan-2-yl)-4H-chromen-4-one → {3,5-dihydroxy-2-[5-hydroxy-2-(4-hydroxyphenyl)-7-methoxy-4-oxo-4H-chromen-8-yl]oxan-4-yl}oxidanesulfonic acid details
5-hydroxy-2-(4-hydroxyphenyl)-7-methoxy-8-(3,4,5-trihydroxyoxan-2-yl)-4H-chromen-4-one → {4,5-dihydroxy-6-[5-hydroxy-2-(4-hydroxyphenyl)-7-methoxy-4-oxo-4H-chromen-8-yl]oxan-3-yl}oxidanesulfonic acid details
5,6-dihydroxy-2-(4-hydroxyphenyl)-7-methoxy-8-(3,4,5-trihydroxyoxan-2-yl)-4H-chromen-4-one → {2-[5,6-dihydroxy-2-(4-hydroxyphenyl)-7-methoxy-4-oxo-4H-chromen-8-yl]-4,5-dihydroxyoxan-3-yl}oxidanesulfonic acid details
5,6-dihydroxy-2-(4-hydroxyphenyl)-7-methoxy-8-(3,4,5-trihydroxyoxan-2-yl)-4H-chromen-4-one → {2-[5,6-dihydroxy-2-(4-hydroxyphenyl)-7-methoxy-4-oxo-4H-chromen-8-yl]-3,5-dihydroxyoxan-4-yl}oxidanesulfonic acid details
5,6-dihydroxy-2-(4-hydroxyphenyl)-7-methoxy-8-(3,4,5-trihydroxyoxan-2-yl)-4H-chromen-4-one → {6-[5,6-dihydroxy-2-(4-hydroxyphenyl)-7-methoxy-4-oxo-4H-chromen-8-yl]-4,5-dihydroxyoxan-3-yl}oxidanesulfonic acid details
2-(3,4-dihydroxyphenyl)-5-hydroxy-7-methoxy-8-(3,4,5-trihydroxyoxan-2-yl)-4H-chromen-4-one → {2-[2-(3,4-dihydroxyphenyl)-5-hydroxy-7-methoxy-4-oxo-4H-chromen-8-yl]-4,5-dihydroxyoxan-3-yl}oxidanesulfonic acid details
2-(3,4-dihydroxyphenyl)-5-hydroxy-7-methoxy-8-(3,4,5-trihydroxyoxan-2-yl)-4H-chromen-4-one → {2-[2-(3,4-dihydroxyphenyl)-5-hydroxy-7-methoxy-4-oxo-4H-chromen-8-yl]-3,5-dihydroxyoxan-4-yl}oxidanesulfonic acid details
2-(3,4-dihydroxyphenyl)-5-hydroxy-7-methoxy-8-(3,4,5-trihydroxyoxan-2-yl)-4H-chromen-4-one → {6-[2-(3,4-dihydroxyphenyl)-5-hydroxy-7-methoxy-4-oxo-4H-chromen-8-yl]-4,5-dihydroxyoxan-3-yl}oxidanesulfonic acid details
5,7-dihydroxy-2-(4-hydroxyphenyl)-8-(3,4,5-trihydroxyoxan-2-yl)-4H-chromen-4-one → {2-[5,7-dihydroxy-2-(4-hydroxyphenyl)-4-oxo-4H-chromen-8-yl]-4,5-dihydroxyoxan-3-yl}oxidanesulfonic acid details
5,7-dihydroxy-2-(4-hydroxyphenyl)-8-(3,4,5-trihydroxyoxan-2-yl)-4H-chromen-4-one → {2-[5,7-dihydroxy-2-(4-hydroxyphenyl)-4-oxo-4H-chromen-8-yl]-3,5-dihydroxyoxan-4-yl}oxidanesulfonic acid details
5,7-dihydroxy-2-(4-hydroxyphenyl)-8-(3,4,5-trihydroxyoxan-2-yl)-4H-chromen-4-one → {6-[5,7-dihydroxy-2-(4-hydroxyphenyl)-4-oxo-4H-chromen-8-yl]-4,5-dihydroxyoxan-3-yl}oxidanesulfonic acid details
5-hydroxy-7-methoxy-2-phenyl-8-(3,4,5-trihydroxyoxan-2-yl)-4H-chromen-4-one → [4,5-dihydroxy-2-(5-hydroxy-7-methoxy-4-oxo-2-phenyl-4H-chromen-8-yl)oxan-3-yl]oxidanesulfonic acid details
5-hydroxy-7-methoxy-2-phenyl-8-(3,4,5-trihydroxyoxan-2-yl)-4H-chromen-4-one → [3,5-dihydroxy-2-(5-hydroxy-7-methoxy-4-oxo-2-phenyl-4H-chromen-8-yl)oxan-4-yl]oxidanesulfonic acid details
5-hydroxy-7-methoxy-2-phenyl-8-(3,4,5-trihydroxyoxan-2-yl)-4H-chromen-4-one → [4,5-dihydroxy-6-(5-hydroxy-7-methoxy-4-oxo-2-phenyl-4H-chromen-8-yl)oxan-3-yl]oxidanesulfonic acid details
5,7-dihydroxy-2-phenyl-8-(3,4,5-trihydroxyoxan-2-yl)-4H-chromen-4-one → [2-(5,7-dihydroxy-4-oxo-2-phenyl-4H-chromen-8-yl)-4,5-dihydroxyoxan-3-yl]oxidanesulfonic acid details
5,7-dihydroxy-2-phenyl-8-(3,4,5-trihydroxyoxan-2-yl)-4H-chromen-4-one → [2-(5,7-dihydroxy-4-oxo-2-phenyl-4H-chromen-8-yl)-3,5-dihydroxyoxan-4-yl]oxidanesulfonic acid details
5,7-dihydroxy-2-phenyl-8-(3,4,5-trihydroxyoxan-2-yl)-4H-chromen-4-one → [6-(5,7-dihydroxy-4-oxo-2-phenyl-4H-chromen-8-yl)-4,5-dihydroxyoxan-3-yl]oxidanesulfonic acid details
5,6,7-trihydroxy-2-(4-hydroxyphenyl)-8-(3,4,5-trihydroxyoxan-2-yl)-4H-chromen-4-one → {4,5-dihydroxy-2-[5,6,7-trihydroxy-2-(4-hydroxyphenyl)-4-oxo-4H-chromen-8-yl]oxan-3-yl}oxidanesulfonic acid details
5,6,7-trihydroxy-2-(4-hydroxyphenyl)-8-(3,4,5-trihydroxyoxan-2-yl)-4H-chromen-4-one → {3,5-dihydroxy-2-[5,6,7-trihydroxy-2-(4-hydroxyphenyl)-4-oxo-4H-chromen-8-yl]oxan-4-yl}oxidanesulfonic acid details
5,6,7-trihydroxy-2-(4-hydroxyphenyl)-8-(3,4,5-trihydroxyoxan-2-yl)-4H-chromen-4-one → {4,5-dihydroxy-6-[5,6,7-trihydroxy-2-(4-hydroxyphenyl)-4-oxo-4H-chromen-8-yl]oxan-3-yl}oxidanesulfonic acid details
5,6-dihydroxy-7-methoxy-2-phenyl-8-(3,4,5-trihydroxyoxan-2-yl)-4H-chromen-4-one → [2-(5,6-dihydroxy-7-methoxy-4-oxo-2-phenyl-4H-chromen-8-yl)-4,5-dihydroxyoxan-3-yl]oxidanesulfonic acid details
5,6-dihydroxy-7-methoxy-2-phenyl-8-(3,4,5-trihydroxyoxan-2-yl)-4H-chromen-4-one → [2-(5,6-dihydroxy-7-methoxy-4-oxo-2-phenyl-4H-chromen-8-yl)-3,5-dihydroxyoxan-4-yl]oxidanesulfonic acid details
5,6-dihydroxy-7-methoxy-2-phenyl-8-(3,4,5-trihydroxyoxan-2-yl)-4H-chromen-4-one → [6-(5,6-dihydroxy-7-methoxy-4-oxo-2-phenyl-4H-chromen-8-yl)-4,5-dihydroxyoxan-3-yl]oxidanesulfonic acid details
5,6,7-trihydroxy-2-phenyl-8-(3,4,5-trihydroxyoxan-2-yl)-4H-chromen-4-one → [4,5-dihydroxy-2-(5,6,7-trihydroxy-4-oxo-2-phenyl-4H-chromen-8-yl)oxan-3-yl]oxidanesulfonic acid details
5,6,7-trihydroxy-2-phenyl-8-(3,4,5-trihydroxyoxan-2-yl)-4H-chromen-4-one → [3,5-dihydroxy-2-(5,6,7-trihydroxy-4-oxo-2-phenyl-4H-chromen-8-yl)oxan-4-yl]oxidanesulfonic acid details
5,6,7-trihydroxy-2-phenyl-8-(3,4,5-trihydroxyoxan-2-yl)-4H-chromen-4-one → [4,5-dihydroxy-6-(5,6,7-trihydroxy-4-oxo-2-phenyl-4H-chromen-8-yl)oxan-3-yl]oxidanesulfonic acid details
2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-8-(3,4,5-trihydroxyoxan-2-yl)-4H-chromen-4-one → {2-[2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-4-oxo-4H-chromen-8-yl]-4,5-dihydroxyoxan-3-yl}oxidanesulfonic acid details
2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-8-(3,4,5-trihydroxyoxan-2-yl)-4H-chromen-4-one → {2-[2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-4-oxo-4H-chromen-8-yl]-3,5-dihydroxyoxan-4-yl}oxidanesulfonic acid details
2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-8-(3,4,5-trihydroxyoxan-2-yl)-4H-chromen-4-one → {6-[2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-4-oxo-4H-chromen-8-yl]-4,5-dihydroxyoxan-3-yl}oxidanesulfonic acid details
5-hydroxy-2-(3-hydroxyphenyl)-7-methoxy-8-(3,4,5-trihydroxyoxan-2-yl)-4H-chromen-4-one → {4,5-dihydroxy-2-[5-hydroxy-2-(3-hydroxyphenyl)-7-methoxy-4-oxo-4H-chromen-8-yl]oxan-3-yl}oxidanesulfonic acid details
5-hydroxy-2-(3-hydroxyphenyl)-7-methoxy-8-(3,4,5-trihydroxyoxan-2-yl)-4H-chromen-4-one → {3,5-dihydroxy-2-[5-hydroxy-2-(3-hydroxyphenyl)-7-methoxy-4-oxo-4H-chromen-8-yl]oxan-4-yl}oxidanesulfonic acid details
5-hydroxy-2-(3-hydroxyphenyl)-7-methoxy-8-(3,4,5-trihydroxyoxan-2-yl)-4H-chromen-4-one → {4,5-dihydroxy-6-[5-hydroxy-2-(3-hydroxyphenyl)-7-methoxy-4-oxo-4H-chromen-8-yl]oxan-3-yl}oxidanesulfonic acid details
5,7-dihydroxy-2-(3-hydroxyphenyl)-8-(3,4,5-trihydroxyoxan-2-yl)-4H-chromen-4-one → {2-[5,7-dihydroxy-2-(3-hydroxyphenyl)-4-oxo-4H-chromen-8-yl]-4,5-dihydroxyoxan-3-yl}oxidanesulfonic acid details
5,7-dihydroxy-2-(3-hydroxyphenyl)-8-(3,4,5-trihydroxyoxan-2-yl)-4H-chromen-4-one → {2-[5,7-dihydroxy-2-(3-hydroxyphenyl)-4-oxo-4H-chromen-8-yl]-3,5-dihydroxyoxan-4-yl}oxidanesulfonic acid details
5,7-dihydroxy-2-(3-hydroxyphenyl)-8-(3,4,5-trihydroxyoxan-2-yl)-4H-chromen-4-one → {6-[5,7-dihydroxy-2-(3-hydroxyphenyl)-4-oxo-4H-chromen-8-yl]-4,5-dihydroxyoxan-3-yl}oxidanesulfonic acid details
Maysin → {2-[2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-4-oxo-4H-chromen-6-yl]-6-methyl-5-oxo-3-[(3,4,5-trihydroxy-6-methyloxan-2-yl)oxy]oxan-4-yl}oxidanesulfonic acid details
6-(3,4-dihydroxy-6-methyl-5-oxooxan-2-yl)-2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-4H-chromen-4-one → {2-[2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-4-oxo-4H-chromen-6-yl]-3-hydroxy-6-methyl-5-oxooxan-4-yl}oxidanesulfonic acid details
6-(3,4-dihydroxy-6-methyl-5-oxooxan-2-yl)-2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-4H-chromen-4-one → {2-[2-(3,4-dihydroxyphenyl)-5,7-dihydroxy-4-oxo-4H-chromen-6-yl]-4-hydroxy-6-methyl-5-oxooxan-3-yl}oxidanesulfonic acid details
6-(3,4-dihydroxy-6-methyl-5-oxooxan-2-yl)-5,7-dihydroxy-2-(3-hydroxyphenyl)-4H-chromen-4-one → {2-[5,7-dihydroxy-2-(3-hydroxyphenyl)-4-oxo-4H-chromen-6-yl]-3-hydroxy-6-methyl-5-oxooxan-4-yl}oxidanesulfonic acid details
6-(3,4-dihydroxy-6-methyl-5-oxooxan-2-yl)-5,7-dihydroxy-2-(3-hydroxyphenyl)-4H-chromen-4-one → {2-[5,7-dihydroxy-2-(3-hydroxyphenyl)-4-oxo-4H-chromen-6-yl]-4-hydroxy-6-methyl-5-oxooxan-3-yl}oxidanesulfonic acid details
6-(3,4-dihydroxy-6-methyl-5-oxooxan-2-yl)-5,7-dihydroxy-2-(4-hydroxy-3-methoxyphenyl)-4H-chromen-4-one → {2-[5,7-dihydroxy-2-(4-hydroxy-3-methoxyphenyl)-4-oxo-4H-chromen-6-yl]-4-hydroxy-6-methyl-5-oxooxan-3-yl}oxidanesulfonic acid details
6-(3,4-dihydroxy-6-methyl-5-oxooxan-2-yl)-5,7-dihydroxy-2-(4-hydroxy-3-methoxyphenyl)-4H-chromen-4-one → {2-[5,7-dihydroxy-2-(4-hydroxy-3-methoxyphenyl)-4-oxo-4H-chromen-6-yl]-3-hydroxy-6-methyl-5-oxooxan-4-yl}oxidanesulfonic acid details
6-(3,4-dihydroxy-6-methyl-5-oxooxan-2-yl)-5,7-dihydroxy-2-(3-methoxyphenyl)-4H-chromen-4-one → {2-[5,7-dihydroxy-2-(3-methoxyphenyl)-4-oxo-4H-chromen-6-yl]-4-hydroxy-6-methyl-5-oxooxan-3-yl}oxidanesulfonic acid details
6-(3,4-dihydroxy-6-methyl-5-oxooxan-2-yl)-5,7-dihydroxy-2-(3-methoxyphenyl)-4H-chromen-4-one → {2-[5,7-dihydroxy-2-(3-methoxyphenyl)-4-oxo-4H-chromen-6-yl]-3-hydroxy-6-methyl-5-oxooxan-4-yl}oxidanesulfonic acid details
Apimaysin → {2-[5,7-dihydroxy-2-(4-hydroxyphenyl)-4-oxo-4H-chromen-6-yl]-6-methyl-5-oxo-3-[(3,4,5-trihydroxy-6-methyloxan-2-yl)oxy]oxan-4-yl}oxidanesulfonic acid details
6-(3,4-dihydroxy-6-methyl-5-oxooxan-2-yl)-5,7-dihydroxy-2-(4-hydroxyphenyl)-4H-chromen-4-one → {2-[5,7-dihydroxy-2-(4-hydroxyphenyl)-4-oxo-4H-chromen-6-yl]-3-hydroxy-6-methyl-5-oxooxan-4-yl}oxidanesulfonic acid details
6-(3,4-dihydroxy-6-methyl-5-oxooxan-2-yl)-5,7-dihydroxy-2-(4-hydroxyphenyl)-4H-chromen-4-one → {2-[5,7-dihydroxy-2-(4-hydroxyphenyl)-4-oxo-4H-chromen-6-yl]-4-hydroxy-6-methyl-5-oxooxan-3-yl}oxidanesulfonic acid details
6-(3,4-dihydroxy-6-methyl-5-oxooxan-2-yl)-5,7-dihydroxy-2-phenyl-4H-chromen-4-one → [2-(5,7-dihydroxy-4-oxo-2-phenyl-4H-chromen-6-yl)-3-hydroxy-6-methyl-5-oxooxan-4-yl]oxidanesulfonic acid details
6-(3,4-dihydroxy-6-methyl-5-oxooxan-2-yl)-5,7-dihydroxy-2-phenyl-4H-chromen-4-one → [2-(5,7-dihydroxy-4-oxo-2-phenyl-4H-chromen-6-yl)-4-hydroxy-6-methyl-5-oxooxan-3-yl]oxidanesulfonic acid details
3,5-dihydroxy-8-(hydroxymethyl)-2-(4-hydroxyphenyl)-8-methyl-4H,8H-pyrano[2,3-f]chromen-4-one → {[3,5-dihydroxy-2-(4-hydroxyphenyl)-8-methyl-4-oxo-4H,8H-pyrano[2,3-f]chromen-8-yl]methoxy}sulfonic acid details
3,5-dihydroxy-8-(hydroxymethyl)-8-methyl-2-phenyl-4H,8H-pyrano[2,3-f]chromen-4-one → ({3,5-dihydroxy-8-methyl-4-oxo-2-phenyl-4H,8H-pyrano[2,3-f]chromen-8-yl}methoxy)sulfonic acid details
2-(2,4-dihydroxyphenyl)-5-hydroxy-8-(hydroxymethyl)-8-methyl-4H,8H-pyrano[3,2-g]chromen-4-one → {[8-(2,4-dihydroxyphenyl)-5-hydroxy-2-methyl-6-oxo-2H,6H-pyrano[3,2-g]chromen-2-yl]methoxy}sulfonic acid details
Kaempferol 3-[apiosyl-(1->2)-galactoside] → ({5-[(2-{[5,7-dihydroxy-2-(4-hydroxyphenyl)-4-oxo-4H-chromen-3-yl]oxy}-4,5-dihydroxy-6-(hydroxymethyl)oxan-3-yl)oxy]-3,4-dihydroxyoxolan-3-yl}methoxy)sulfonic acid details
Kaempferol 3-[apiosyl-(1->2)-galactoside] → {2-[(2-{[5,7-dihydroxy-2-(4-hydroxyphenyl)-4-oxo-4H-chromen-3-yl]oxy}-4,5-dihydroxy-6-(hydroxymethyl)oxan-3-yl)oxy]-4-hydroxy-4-(hydroxymethyl)oxolan-3-yl}oxidanesulfonic acid details
3,5,7-trihydroxy-2-(4-methoxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-one → [5,7-dihydroxy-2-(4-methoxyphenyl)-4-oxo-3,4-dihydro-2H-1-benzopyran-3-yl]oxidanesulfonic acid details
3,5,6,7-tetrahydroxy-2-(4-methoxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-one → [5,6,7-trihydroxy-2-(4-methoxyphenyl)-4-oxo-3,4-dihydro-2H-1-benzopyran-3-yl]oxidanesulfonic acid details
3-hydroxy-2-(hydroxymethyl)-2-methylpropanoic acid → 3-hydroxy-2-methyl-2-[(sulfooxy)methyl]propanoic acid details
(1R,12S,16Z,24E,26E,28Z,32S)-1,18-dihydroxy-12-[1-(4-hydroxy-3-methoxycyclohexyl)propan-2-yl]-19,30-dimethoxy-15,17,21,23,29,35-hexamethyl-11,36-dioxa-4-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraene-2,3,10,14,20-pentone → (4-{2-[(1R,16Z,24E,26E,28Z)-1,18-dihydroxy-19,30-dimethoxy-15,17,21,23,29,35-hexamethyl-2,3,10,14,20-pentaoxo-11,36-dioxa-4-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraen-12-yl]propyl}-2-methoxycyclohexyl)oxidanesulfonic acid details
(1R,12S,16Z,24E,26E,28Z,32S)-1,18-dihydroxy-12-[1-(4-hydroxy-3-methoxycyclohexyl)propan-2-yl]-19,30-dimethoxy-15,17,21,23,29,35-hexamethyl-11,36-dioxa-4-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraene-2,3,10,14,20-pentone → [(1R,16Z,24E,26E,28Z)-1-hydroxy-12-[1-(4-hydroxy-3-methoxycyclohexyl)propan-2-yl]-19,30-dimethoxy-15,17,21,23,29,35-hexamethyl-2,3,10,14,20-pentaoxo-11,36-dioxa-4-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraen-18-yl]oxidanesulfonic acid details
3-hydroxy-2,2-bis(hydroxymethyl)propanoic acid → 3-hydroxy-2-(hydroxymethyl)-2-[(sulfooxy)methyl]propanoic acid details
(1R,16Z,24E,26E,28Z)-1,18-dihydroxy-12-[1-(4-hydroxy-3-methoxycyclohexyl)propan-2-yl]-29-(hydroxymethyl)-19,30-dimethoxy-15,17,21,23,35-pentamethyl-11,36-dioxa-4-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraene-2,3,10,14,20-pentone → {[(1R,16Z,24E,26E,28Z)-1,18-dihydroxy-12-[1-(4-hydroxy-3-methoxycyclohexyl)propan-2-yl]-19,30-dimethoxy-15,17,21,23,35-pentamethyl-2,3,10,14,20-pentaoxo-11,36-dioxa-4-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraen-29-yl]methoxy}sulfonic acid details
(1R,16Z,24E,26E,28Z)-1,18-dihydroxy-12-[1-(4-hydroxy-3-methoxycyclohexyl)propan-2-yl]-29-(hydroxymethyl)-19,30-dimethoxy-15,17,21,23,35-pentamethyl-11,36-dioxa-4-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraene-2,3,10,14,20-pentone → (4-{2-[(1R,16Z,24E,26E,28Z)-1,18-dihydroxy-29-(hydroxymethyl)-19,30-dimethoxy-15,17,21,23,35-pentamethyl-2,3,10,14,20-pentaoxo-11,36-dioxa-4-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraen-12-yl]propyl}-2-methoxycyclohexyl)oxidanesulfonic acid details
(1R,16Z,24E,26E,28Z)-1,18,23-trihydroxy-12-[1-(4-hydroxy-3-methoxycyclohexyl)propan-2-yl]-19,30-dimethoxy-15,17,21,23,29,35-hexamethyl-11,36-dioxa-4-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraene-2,3,10,14,20-pentone → (2-methoxy-4-{2-[(1R,16Z,24E,26E,28Z)-1,18,23-trihydroxy-19,30-dimethoxy-15,17,21,23,29,35-hexamethyl-2,3,10,14,20-pentaoxo-11,36-dioxa-4-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraen-12-yl]propyl}cyclohexyl)oxidanesulfonic acid details
(1R,16Z,24E,26E,28Z)-1,18,23-trihydroxy-12-[1-(4-hydroxy-3-methoxycyclohexyl)propan-2-yl]-19,30-dimethoxy-15,17,21,23,29,35-hexamethyl-11,36-dioxa-4-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraene-2,3,10,14,20-pentone → [(1R,16Z,24E,26E,28Z)-1,23-dihydroxy-12-[1-(4-hydroxy-3-methoxycyclohexyl)propan-2-yl]-19,30-dimethoxy-15,17,21,23,29,35-hexamethyl-2,3,10,14,20-pentaoxo-11,36-dioxa-4-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraen-18-yl]oxidanesulfonic acid details
(1R,16Z,24E,26E,28Z)-1,18-dihydroxy-12-[1-(4-hydroxy-3-methoxycyclohexyl)propan-2-yl]-17-(hydroxymethyl)-19,30-dimethoxy-15,21,23,29,35-pentamethyl-11,36-dioxa-4-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraene-2,3,10,14,20-pentone → {[(1R,16Z,24E,26E,28Z)-1,18-dihydroxy-12-[1-(4-hydroxy-3-methoxycyclohexyl)propan-2-yl]-19,30-dimethoxy-15,21,23,29,35-pentamethyl-2,3,10,14,20-pentaoxo-11,36-dioxa-4-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraen-17-yl]methoxy}sulfonic acid details
(1R,16Z,24E,26E,28Z)-1,18-dihydroxy-12-[1-(4-hydroxy-3-methoxycyclohexyl)propan-2-yl]-17-(hydroxymethyl)-19,30-dimethoxy-15,21,23,29,35-pentamethyl-11,36-dioxa-4-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraene-2,3,10,14,20-pentone → (4-{2-[(1R,16Z,24E,26E,28Z)-1,18-dihydroxy-17-(hydroxymethyl)-19,30-dimethoxy-15,21,23,29,35-pentamethyl-2,3,10,14,20-pentaoxo-11,36-dioxa-4-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraen-12-yl]propyl}-2-methoxycyclohexyl)oxidanesulfonic acid details
(1R,16Z,24E,26E,28Z)-1,18,35-trihydroxy-12-[1-(4-hydroxy-3-methoxycyclohexyl)propan-2-yl]-19,30-dimethoxy-15,17,21,23,29,35-hexamethyl-11,36-dioxa-4-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraene-2,3,10,14,20-pentone → (2-methoxy-4-{2-[(1R,16Z,24E,26E,28Z)-1,18,35-trihydroxy-19,30-dimethoxy-15,17,21,23,29,35-hexamethyl-2,3,10,14,20-pentaoxo-11,36-dioxa-4-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraen-12-yl]propyl}cyclohexyl)oxidanesulfonic acid details
(1R,16Z,24E,26E,28Z)-1,18,35-trihydroxy-12-[1-(4-hydroxy-3-methoxycyclohexyl)propan-2-yl]-19,30-dimethoxy-15,17,21,23,29,35-hexamethyl-11,36-dioxa-4-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraene-2,3,10,14,20-pentone → [(1R,16Z,24E,26E,28Z)-1,35-dihydroxy-12-[1-(4-hydroxy-3-methoxycyclohexyl)propan-2-yl]-19,30-dimethoxy-15,17,21,23,29,35-hexamethyl-2,3,10,14,20-pentaoxo-11,36-dioxa-4-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraen-18-yl]oxidanesulfonic acid details
(1R,16Z,24E,26E,28Z)-1,18,21-trihydroxy-12-[1-(4-hydroxy-3-methoxycyclohexyl)propan-2-yl]-19,30-dimethoxy-15,17,21,23,29,35-hexamethyl-11,36-dioxa-4-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraene-2,3,10,14,20-pentone → (2-methoxy-4-{2-[(1R,16Z,24E,26E,28Z)-1,18,21-trihydroxy-19,30-dimethoxy-15,17,21,23,29,35-hexamethyl-2,3,10,14,20-pentaoxo-11,36-dioxa-4-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraen-12-yl]propyl}cyclohexyl)oxidanesulfonic acid details
(1R,16Z,24E,26E,28Z)-1,18,21-trihydroxy-12-[1-(4-hydroxy-3-methoxycyclohexyl)propan-2-yl]-19,30-dimethoxy-15,17,21,23,29,35-hexamethyl-11,36-dioxa-4-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraene-2,3,10,14,20-pentone → [(1R,16Z,24E,26E,28Z)-1,21-dihydroxy-12-[1-(4-hydroxy-3-methoxycyclohexyl)propan-2-yl]-19,30-dimethoxy-15,17,21,23,29,35-hexamethyl-2,3,10,14,20-pentaoxo-11,36-dioxa-4-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraen-18-yl]oxidanesulfonic acid details
(1R,16Z,24E,26E,28Z)-1,15,18-trihydroxy-12-[1-(4-hydroxy-3-methoxycyclohexyl)propan-2-yl]-19,30-dimethoxy-15,17,21,23,29,35-hexamethyl-11,36-dioxa-4-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraene-2,3,10,14,20-pentone → (2-methoxy-4-{2-[(1R,16Z,24E,26E,28Z)-1,15,18-trihydroxy-19,30-dimethoxy-15,17,21,23,29,35-hexamethyl-2,3,10,14,20-pentaoxo-11,36-dioxa-4-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraen-12-yl]propyl}cyclohexyl)oxidanesulfonic acid details
(1R,16Z,24E,26E,28Z)-1,15,18-trihydroxy-12-[1-(4-hydroxy-3-methoxycyclohexyl)propan-2-yl]-19,30-dimethoxy-15,17,21,23,29,35-hexamethyl-11,36-dioxa-4-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraene-2,3,10,14,20-pentone → [(1R,16Z,24E,26E,28Z)-1,15-dihydroxy-12-[1-(4-hydroxy-3-methoxycyclohexyl)propan-2-yl]-19,30-dimethoxy-15,17,21,23,29,35-hexamethyl-2,3,10,14,20-pentaoxo-11,36-dioxa-4-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraen-18-yl]oxidanesulfonic acid details
(1R,16Z,24E,26E,28Z)-1,18-dihydroxy-12-[2-hydroxy-1-(4-hydroxy-3-methoxycyclohexyl)propan-2-yl]-19,30-dimethoxy-15,17,21,23,29,35-hexamethyl-11,36-dioxa-4-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraene-2,3,10,14,20-pentone → (4-{2-[(1R,16Z,24E,26E,28Z)-1,18-dihydroxy-19,30-dimethoxy-15,17,21,23,29,35-hexamethyl-2,3,10,14,20-pentaoxo-11,36-dioxa-4-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraen-12-yl]-2-hydroxypropyl}-2-methoxycyclohexyl)oxidanesulfonic acid details
(1S,16Z,24E,26E,28Z)-12-[1-(2,4-dihydroxy-3-methoxycyclohexyl)propan-2-yl]-1,18-dihydroxy-19,30-dimethoxy-15,17,21,23,29,35-hexamethyl-11,36-dioxa-4-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraene-2,3,10,14,20-pentone → (6-{2-[(1S,16Z,24E,26E,28Z)-1,18-dihydroxy-19,30-dimethoxy-15,17,21,23,29,35-hexamethyl-2,3,10,14,20-pentaoxo-11,36-dioxa-4-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraen-12-yl]propyl}-3-hydroxy-2-methoxycyclohexyl)oxidanesulfonic acid details
(1S,16Z,24E,26E,28Z)-12-[1-(2,4-dihydroxy-3-methoxycyclohexyl)propan-2-yl]-1,18-dihydroxy-19,30-dimethoxy-15,17,21,23,29,35-hexamethyl-11,36-dioxa-4-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraene-2,3,10,14,20-pentone → (4-{2-[(1S,16Z,24E,26E,28Z)-1,18-dihydroxy-19,30-dimethoxy-15,17,21,23,29,35-hexamethyl-2,3,10,14,20-pentaoxo-11,36-dioxa-4-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraen-12-yl]propyl}-3-hydroxy-2-methoxycyclohexyl)oxidanesulfonic acid details
(1S,16Z,24E,26E,28Z)-12-[1-(2,4-dihydroxy-3-methoxycyclohexyl)propan-2-yl]-1,18-dihydroxy-19,30-dimethoxy-15,17,21,23,29,35-hexamethyl-11,36-dioxa-4-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraene-2,3,10,14,20-pentone → [(1S,16Z,24E,26E,28Z)-12-[1-(2,4-dihydroxy-3-methoxycyclohexyl)propan-2-yl]-1-hydroxy-19,30-dimethoxy-15,17,21,23,29,35-hexamethyl-2,3,10,14,20-pentaoxo-11,36-dioxa-4-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraen-18-yl]oxidanesulfonic acid details
(1S,16Z,24E,26E,28Z)-12-[1-(1,4-dihydroxy-3-methoxycyclohexyl)propan-2-yl]-1,18-dihydroxy-19,30-dimethoxy-15,17,21,23,29,35-hexamethyl-11,36-dioxa-4-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraene-2,3,10,14,20-pentone → (4-{2-[(1S,16Z,24E,26E,28Z)-1,18-dihydroxy-19,30-dimethoxy-15,17,21,23,29,35-hexamethyl-2,3,10,14,20-pentaoxo-11,36-dioxa-4-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraen-12-yl]propyl}-4-hydroxy-2-methoxycyclohexyl)oxidanesulfonic acid details
(1S,16Z,24E,26E,28Z)-12-[1-(1,4-dihydroxy-3-methoxycyclohexyl)propan-2-yl]-1,18-dihydroxy-19,30-dimethoxy-15,17,21,23,29,35-hexamethyl-11,36-dioxa-4-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraene-2,3,10,14,20-pentone → [(1S,16Z,24E,26E,28Z)-12-[1-(1,4-dihydroxy-3-methoxycyclohexyl)propan-2-yl]-1-hydroxy-19,30-dimethoxy-15,17,21,23,29,35-hexamethyl-2,3,10,14,20-pentaoxo-11,36-dioxa-4-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraen-18-yl]oxidanesulfonic acid details
(1R,16Z,24E,26E,28Z)-12-[1-(2,4-dihydroxy-5-methoxycyclohexyl)propan-2-yl]-1,18-dihydroxy-19,30-dimethoxy-15,17,21,23,29,35-hexamethyl-11,36-dioxa-4-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraene-2,3,10,14,20-pentone → (2-{2-[(1R,16Z,24E,26E,28Z)-1,18-dihydroxy-19,30-dimethoxy-15,17,21,23,29,35-hexamethyl-2,3,10,14,20-pentaoxo-11,36-dioxa-4-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraen-12-yl]propyl}-5-hydroxy-4-methoxycyclohexyl)oxidanesulfonic acid details
(1R,16Z,24E,26E,28Z)-12-[1-(2,4-dihydroxy-5-methoxycyclohexyl)propan-2-yl]-1,18-dihydroxy-19,30-dimethoxy-15,17,21,23,29,35-hexamethyl-11,36-dioxa-4-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraene-2,3,10,14,20-pentone → (4-{2-[(1R,16Z,24E,26E,28Z)-1,18-dihydroxy-19,30-dimethoxy-15,17,21,23,29,35-hexamethyl-2,3,10,14,20-pentaoxo-11,36-dioxa-4-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraen-12-yl]propyl}-5-hydroxy-2-methoxycyclohexyl)oxidanesulfonic acid details
(1R,16Z,24E,26E,28Z)-12-[1-(2,4-dihydroxy-5-methoxycyclohexyl)propan-2-yl]-1,18-dihydroxy-19,30-dimethoxy-15,17,21,23,29,35-hexamethyl-11,36-dioxa-4-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraene-2,3,10,14,20-pentone → [(1R,16Z,24E,26E,28Z)-12-[1-(2,4-dihydroxy-5-methoxycyclohexyl)propan-2-yl]-1-hydroxy-19,30-dimethoxy-15,17,21,23,29,35-hexamethyl-2,3,10,14,20-pentaoxo-11,36-dioxa-4-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraen-18-yl]oxidanesulfonic acid details
(1R,16Z,24E,26E,28Z)-12-[1-(3,4-dihydroxy-5-methoxycyclohexyl)propan-2-yl]-1,18-dihydroxy-19,30-dimethoxy-15,17,21,23,29,35-hexamethyl-11,36-dioxa-4-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraene-2,3,10,14,20-pentone → (5-{2-[(1R,16Z,24E,26E,28Z)-1,18-dihydroxy-19,30-dimethoxy-15,17,21,23,29,35-hexamethyl-2,3,10,14,20-pentaoxo-11,36-dioxa-4-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraen-12-yl]propyl}-2-hydroxy-3-methoxycyclohexyl)oxidanesulfonic acid details
(1R,16Z,24E,26E,28Z)-12-[1-(3,4-dihydroxy-5-methoxycyclohexyl)propan-2-yl]-1,18-dihydroxy-19,30-dimethoxy-15,17,21,23,29,35-hexamethyl-11,36-dioxa-4-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraene-2,3,10,14,20-pentone → (4-{2-[(1R,16Z,24E,26E,28Z)-1,18-dihydroxy-19,30-dimethoxy-15,17,21,23,29,35-hexamethyl-2,3,10,14,20-pentaoxo-11,36-dioxa-4-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraen-12-yl]propyl}-2-hydroxy-6-methoxycyclohexyl)oxidanesulfonic acid details
(1R,16Z,24E,26E,28Z)-12-[1-(3,4-dihydroxy-5-methoxycyclohexyl)propan-2-yl]-1,18-dihydroxy-19,30-dimethoxy-15,17,21,23,29,35-hexamethyl-11,36-dioxa-4-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraene-2,3,10,14,20-pentone → [(1R,16Z,24E,26E,28Z)-12-[1-(3,4-dihydroxy-5-methoxycyclohexyl)propan-2-yl]-1-hydroxy-19,30-dimethoxy-15,17,21,23,29,35-hexamethyl-2,3,10,14,20-pentaoxo-11,36-dioxa-4-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraen-18-yl]oxidanesulfonic acid details
(1R,16Z,24E,26E,28Z)-1,18-dihydroxy-12-[1-hydroxy-3-(4-hydroxy-3-methoxycyclohexyl)propan-2-yl]-19,30-dimethoxy-15,17,21,23,29,35-hexamethyl-11,36-dioxa-4-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraene-2,3,10,14,20-pentone → {2-[(1R,16Z,24E,26E,28Z)-1,18-dihydroxy-19,30-dimethoxy-15,17,21,23,29,35-hexamethyl-2,3,10,14,20-pentaoxo-11,36-dioxa-4-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraen-12-yl]-3-(4-hydroxy-3-methoxycyclohexyl)propoxy}sulfonic acid details
(1R,16Z,24E,26E,28Z)-1,18-dihydroxy-12-[1-hydroxy-3-(4-hydroxy-3-methoxycyclohexyl)propan-2-yl]-19,30-dimethoxy-15,17,21,23,29,35-hexamethyl-11,36-dioxa-4-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraene-2,3,10,14,20-pentone → (4-{2-[(1R,16Z,24E,26E,28Z)-1,18-dihydroxy-19,30-dimethoxy-15,17,21,23,29,35-hexamethyl-2,3,10,14,20-pentaoxo-11,36-dioxa-4-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraen-12-yl]-3-hydroxypropyl}-2-methoxycyclohexyl)oxidanesulfonic acid details
(1R,16Z,24E,26E,28Z)-1,18-dihydroxy-12-[1-(4-hydroxy-3-methoxycyclohexyl)propan-2-yl]-35-(hydroxymethyl)-19,30-dimethoxy-15,17,21,23,29-pentamethyl-11,36-dioxa-4-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraene-2,3,10,14,20-pentone → {[(1R,16Z,24E,26E,28Z)-1,18-dihydroxy-12-[1-(4-hydroxy-3-methoxycyclohexyl)propan-2-yl]-19,30-dimethoxy-15,17,21,23,29-pentamethyl-2,3,10,14,20-pentaoxo-11,36-dioxa-4-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraen-35-yl]methoxy}sulfonic acid details
(1R,16Z,24E,26E,28Z)-1,18-dihydroxy-12-[1-(4-hydroxy-3-methoxycyclohexyl)propan-2-yl]-35-(hydroxymethyl)-19,30-dimethoxy-15,17,21,23,29-pentamethyl-11,36-dioxa-4-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraene-2,3,10,14,20-pentone → (4-{2-[(1R,16Z,24E,26E,28Z)-1,18-dihydroxy-35-(hydroxymethyl)-19,30-dimethoxy-15,17,21,23,29-pentamethyl-2,3,10,14,20-pentaoxo-11,36-dioxa-4-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraen-12-yl]propyl}-2-methoxycyclohexyl)oxidanesulfonic acid details
(1R,16Z,24E,26E,28Z)-1,18-dihydroxy-12-[1-(4-hydroxy-3-methoxycyclohexyl)propan-2-yl]-23-(hydroxymethyl)-19,30-dimethoxy-15,17,21,29,35-pentamethyl-11,36-dioxa-4-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraene-2,3,10,14,20-pentone → {[(1R,16Z,24E,26E,28Z)-1,18-dihydroxy-12-[1-(4-hydroxy-3-methoxycyclohexyl)propan-2-yl]-19,30-dimethoxy-15,17,21,29,35-pentamethyl-2,3,10,14,20-pentaoxo-11,36-dioxa-4-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraen-23-yl]methoxy}sulfonic acid details
(1R,16Z,24E,26E,28Z)-1,18-dihydroxy-12-[1-(4-hydroxy-3-methoxycyclohexyl)propan-2-yl]-23-(hydroxymethyl)-19,30-dimethoxy-15,17,21,29,35-pentamethyl-11,36-dioxa-4-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraene-2,3,10,14,20-pentone → (4-{2-[(1R,16Z,24E,26E,28Z)-1,18-dihydroxy-23-(hydroxymethyl)-19,30-dimethoxy-15,17,21,29,35-pentamethyl-2,3,10,14,20-pentaoxo-11,36-dioxa-4-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraen-12-yl]propyl}-2-methoxycyclohexyl)oxidanesulfonic acid details
(1R,16Z,24E,26E,28Z)-1,18-dihydroxy-12-[1-(4-hydroxy-3-methoxycyclohexyl)propan-2-yl]-21-(hydroxymethyl)-19,30-dimethoxy-15,17,23,29,35-pentamethyl-11,36-dioxa-4-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraene-2,3,10,14,20-pentone → {[(1R,16Z,24E,26E,28Z)-1,18-dihydroxy-12-[1-(4-hydroxy-3-methoxycyclohexyl)propan-2-yl]-19,30-dimethoxy-15,17,23,29,35-pentamethyl-2,3,10,14,20-pentaoxo-11,36-dioxa-4-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraen-21-yl]methoxy}sulfonic acid details
(1R,16Z,24E,26E,28Z)-1,18-dihydroxy-12-[1-(4-hydroxy-3-methoxycyclohexyl)propan-2-yl]-21-(hydroxymethyl)-19,30-dimethoxy-15,17,23,29,35-pentamethyl-11,36-dioxa-4-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraene-2,3,10,14,20-pentone → (4-{2-[(1R,16Z,24E,26E,28Z)-1,18-dihydroxy-21-(hydroxymethyl)-19,30-dimethoxy-15,17,23,29,35-pentamethyl-2,3,10,14,20-pentaoxo-11,36-dioxa-4-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraen-12-yl]propyl}-2-methoxycyclohexyl)oxidanesulfonic acid details
(1R,16Z,24E,26E,28Z)-1,18-dihydroxy-12-[1-(4-hydroxy-3-methoxycyclohexyl)propan-2-yl]-15-(hydroxymethyl)-19,30-dimethoxy-17,21,23,29,35-pentamethyl-11,36-dioxa-4-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraene-2,3,10,14,20-pentone → {[(1R,16Z,24E,26E,28Z)-1,18-dihydroxy-12-[1-(4-hydroxy-3-methoxycyclohexyl)propan-2-yl]-19,30-dimethoxy-17,21,23,29,35-pentamethyl-2,3,10,14,20-pentaoxo-11,36-dioxa-4-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraen-15-yl]methoxy}sulfonic acid details
(1R,16Z,24E,26E,28Z)-1,18-dihydroxy-12-[1-(4-hydroxy-3-methoxycyclohexyl)propan-2-yl]-15-(hydroxymethyl)-19,30-dimethoxy-17,21,23,29,35-pentamethyl-11,36-dioxa-4-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraene-2,3,10,14,20-pentone → (4-{2-[(1R,16Z,24E,26E,28Z)-1,18-dihydroxy-15-(hydroxymethyl)-19,30-dimethoxy-17,21,23,29,35-pentamethyl-2,3,10,14,20-pentaoxo-11,36-dioxa-4-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraen-12-yl]propyl}-2-methoxycyclohexyl)oxidanesulfonic acid details
(1R,16Z,24E,26E,28Z)-12-[1-(3,4-dihydroxycyclohexyl)propan-2-yl]-1,18-dihydroxy-19,30-dimethoxy-15,17,21,23,29,35-hexamethyl-11,36-dioxa-4-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraene-2,3,10,14,20-pentone → (4-{2-[(1R,16Z,24E,26E,28Z)-1,18-dihydroxy-19,30-dimethoxy-15,17,21,23,29,35-hexamethyl-2,3,10,14,20-pentaoxo-11,36-dioxa-4-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraen-12-yl]propyl}-2-hydroxycyclohexyl)oxidanesulfonic acid details
(1R,16Z,24E,26E,28Z)-12-[1-(3,4-dihydroxycyclohexyl)propan-2-yl]-1,18-dihydroxy-19,30-dimethoxy-15,17,21,23,29,35-hexamethyl-11,36-dioxa-4-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraene-2,3,10,14,20-pentone → (5-{2-[(1R,16Z,24E,26E,28Z)-1,18-dihydroxy-19,30-dimethoxy-15,17,21,23,29,35-hexamethyl-2,3,10,14,20-pentaoxo-11,36-dioxa-4-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraen-12-yl]propyl}-2-hydroxycyclohexyl)oxidanesulfonic acid details
(1R,16Z,24E,26E,28Z)-12-[1-(3,4-dihydroxycyclohexyl)propan-2-yl]-1,18-dihydroxy-19,30-dimethoxy-15,17,21,23,29,35-hexamethyl-11,36-dioxa-4-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraene-2,3,10,14,20-pentone → [(1R,16Z,24E,26E,28Z)-12-[1-(3,4-dihydroxycyclohexyl)propan-2-yl]-1-hydroxy-19,30-dimethoxy-15,17,21,23,29,35-hexamethyl-2,3,10,14,20-pentaoxo-11,36-dioxa-4-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraen-18-yl]oxidanesulfonic acid details
(1R,16Z,24E,26E,28Z)-1,18,30-trihydroxy-12-[1-(4-hydroxy-3-methoxycyclohexyl)propan-2-yl]-19-methoxy-15,17,21,23,29,35-hexamethyl-11,36-dioxa-4-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraene-2,3,10,14,20-pentone → (2-methoxy-4-{2-[(1R,16Z,24E,26E,28Z)-1,18,30-trihydroxy-19-methoxy-15,17,21,23,29,35-hexamethyl-2,3,10,14,20-pentaoxo-11,36-dioxa-4-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraen-12-yl]propyl}cyclohexyl)oxidanesulfonic acid details
(1R,16Z,24E,26E,28Z)-1,18,30-trihydroxy-12-[1-(4-hydroxy-3-methoxycyclohexyl)propan-2-yl]-19-methoxy-15,17,21,23,29,35-hexamethyl-11,36-dioxa-4-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraene-2,3,10,14,20-pentone → [(1R,16Z,24E,26E,28Z)-1,18-dihydroxy-12-[1-(4-hydroxy-3-methoxycyclohexyl)propan-2-yl]-19-methoxy-15,17,21,23,29,35-hexamethyl-2,3,10,14,20-pentaoxo-11,36-dioxa-4-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraen-30-yl]oxidanesulfonic acid details
(1R,16Z,24E,26E,28Z)-1,18,30-trihydroxy-12-[1-(4-hydroxy-3-methoxycyclohexyl)propan-2-yl]-19-methoxy-15,17,21,23,29,35-hexamethyl-11,36-dioxa-4-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraene-2,3,10,14,20-pentone → [(1R,16Z,24E,26E,28Z)-1,30-dihydroxy-12-[1-(4-hydroxy-3-methoxycyclohexyl)propan-2-yl]-19-methoxy-15,17,21,23,29,35-hexamethyl-2,3,10,14,20-pentaoxo-11,36-dioxa-4-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraen-18-yl]oxidanesulfonic acid details
(1R,16Z,24E,26E,28Z)-1,18,19-trihydroxy-12-[1-(4-hydroxy-3-methoxycyclohexyl)propan-2-yl]-30-methoxy-15,17,21,23,29,35-hexamethyl-11,36-dioxa-4-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraene-2,3,10,14,20-pentone → (2-methoxy-4-{2-[(1R,16Z,24E,26E,28Z)-1,18,19-trihydroxy-30-methoxy-15,17,21,23,29,35-hexamethyl-2,3,10,14,20-pentaoxo-11,36-dioxa-4-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraen-12-yl]propyl}cyclohexyl)oxidanesulfonic acid details
(1R,16Z,24E,26E,28Z)-1,18,19-trihydroxy-12-[1-(4-hydroxy-3-methoxycyclohexyl)propan-2-yl]-30-methoxy-15,17,21,23,29,35-hexamethyl-11,36-dioxa-4-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraene-2,3,10,14,20-pentone → [(1R,16Z,24E,26E,28Z)-1,18-dihydroxy-12-[1-(4-hydroxy-3-methoxycyclohexyl)propan-2-yl]-30-methoxy-15,17,21,23,29,35-hexamethyl-2,3,10,14,20-pentaoxo-11,36-dioxa-4-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraen-19-yl]oxidanesulfonic acid details
(1R,16Z,24E,26E,28Z)-1,18,19-trihydroxy-12-[1-(4-hydroxy-3-methoxycyclohexyl)propan-2-yl]-30-methoxy-15,17,21,23,29,35-hexamethyl-11,36-dioxa-4-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraene-2,3,10,14,20-pentone → [(1R,16Z,24E,26E,28Z)-1,19-dihydroxy-12-[1-(4-hydroxy-3-methoxycyclohexyl)propan-2-yl]-30-methoxy-15,17,21,23,29,35-hexamethyl-2,3,10,14,20-pentaoxo-11,36-dioxa-4-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraen-18-yl]oxidanesulfonic acid details
(1R,16Z,24E,26E,28Z)-1,5,18-trihydroxy-12-[1-(4-hydroxy-3-methoxycyclohexyl)propan-2-yl]-19,30-dimethoxy-15,17,21,23,29,35-hexamethyl-11,36-dioxa-4-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraene-2,3,10,14,20-pentone → (2-methoxy-4-{2-[(1R,16Z,24E,26E,28Z)-1,5,18-trihydroxy-19,30-dimethoxy-15,17,21,23,29,35-hexamethyl-2,3,10,14,20-pentaoxo-11,36-dioxa-4-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraen-12-yl]propyl}cyclohexyl)oxidanesulfonic acid details
(1R,16Z,24E,26E,28Z)-1,5,18-trihydroxy-12-[1-(4-hydroxy-3-methoxycyclohexyl)propan-2-yl]-19,30-dimethoxy-15,17,21,23,29,35-hexamethyl-11,36-dioxa-4-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraene-2,3,10,14,20-pentone → [(1R,16Z,24E,26E,28Z)-1,5-dihydroxy-12-[1-(4-hydroxy-3-methoxycyclohexyl)propan-2-yl]-19,30-dimethoxy-15,17,21,23,29,35-hexamethyl-2,3,10,14,20-pentaoxo-11,36-dioxa-4-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraen-18-yl]oxidanesulfonic acid details
(7E,9E,17Z,33R)-16,33-dihydroxy-22-[1-(4-hydroxy-3-methoxycyclohexyl)propan-2-yl]-3,15-dimethoxy-4,11,13,17,19,34-hexamethyl-5,23,37-trioxa-30-azatetracyclo[31.3.1.0⁴,⁶.0²⁵,³⁰]heptatriaconta-7,9,17-triene-14,20,24,31,32-pentone → (4-{2-[(7E,9E,17Z,33R)-16,33-dihydroxy-3,15-dimethoxy-4,11,13,17,19,34-hexamethyl-14,20,24,31,32-pentaoxo-5,23,37-trioxa-30-azatetracyclo[31.3.1.0⁴,⁶.0²⁵,³⁰]heptatriaconta-7,9,17-trien-22-yl]propyl}-2-methoxycyclohexyl)oxidanesulfonic acid details
(7E,9E,17Z,33R)-16,33-dihydroxy-22-[1-(4-hydroxy-3-methoxycyclohexyl)propan-2-yl]-3,15-dimethoxy-4,11,13,17,19,34-hexamethyl-5,23,37-trioxa-30-azatetracyclo[31.3.1.0⁴,⁶.0²⁵,³⁰]heptatriaconta-7,9,17-triene-14,20,24,31,32-pentone → [(7E,9E,17Z,33R)-33-hydroxy-22-[1-(4-hydroxy-3-methoxycyclohexyl)propan-2-yl]-3,15-dimethoxy-4,11,13,17,19,34-hexamethyl-14,20,24,31,32-pentaoxo-5,23,37-trioxa-30-azatetracyclo[31.3.1.0⁴,⁶.0²⁵,³⁰]heptatriaconta-7,9,17-trien-16-yl]oxidanesulfonic acid details
(1R,16Z,27Z,29Z)-1,18-dihydroxy-12-[1-(4-hydroxy-3-methoxycyclohexyl)propan-2-yl]-19,31-dimethoxy-15,17,21,23,30,36-hexamethyl-11,25,37-trioxa-4-azatetracyclo[31.3.1.0⁴,⁹.0²⁴,²⁶]heptatriaconta-16,27,29-triene-2,3,10,14,20-pentone → (4-{2-[(1R,16Z,27Z,29Z)-1,18-dihydroxy-19,31-dimethoxy-15,17,21,23,30,36-hexamethyl-2,3,10,14,20-pentaoxo-11,25,37-trioxa-4-azatetracyclo[31.3.1.0⁴,⁹.0²⁴,²⁶]heptatriaconta-16,27,29-trien-12-yl]propyl}-2-methoxycyclohexyl)oxidanesulfonic acid details
(1R,16Z,27Z,29Z)-1,18-dihydroxy-12-[1-(4-hydroxy-3-methoxycyclohexyl)propan-2-yl]-19,31-dimethoxy-15,17,21,23,30,36-hexamethyl-11,25,37-trioxa-4-azatetracyclo[31.3.1.0⁴,⁹.0²⁴,²⁶]heptatriaconta-16,27,29-triene-2,3,10,14,20-pentone → [(1R,16E,27Z,29Z)-1-hydroxy-12-[1-(4-hydroxy-3-methoxycyclohexyl)propan-2-yl]-19,31-dimethoxy-15,17,21,23,30,36-hexamethyl-2,3,10,14,20-pentaoxo-11,25,37-trioxa-4-azatetracyclo[31.3.1.0⁴,⁹.0²⁴,²⁶]heptatriaconta-16,27,29-trien-18-yl]oxidanesulfonic acid details
(1R,25E,27E,29Z)-1,19-dihydroxy-12-[1-(4-hydroxy-3-methoxycyclohexyl)propan-2-yl]-20,31-dimethoxy-15,18,22,24,30,36-hexamethyl-11,17,37-trioxa-4-azatetracyclo[31.3.1.0⁴,⁹.0¹⁶,¹⁸]heptatriaconta-25,27,29-triene-2,3,10,14,21-pentone → (4-{2-[(1R,25E,27E,29Z)-1,19-dihydroxy-20,31-dimethoxy-15,18,22,24,30,36-hexamethyl-2,3,10,14,21-pentaoxo-11,17,37-trioxa-4-azatetracyclo[31.3.1.0⁴,⁹.0¹⁶,¹⁸]heptatriaconta-25,27,29-trien-12-yl]propyl}-2-methoxycyclohexyl)oxidanesulfonic acid details
(1R,25E,27E,29Z)-1,19-dihydroxy-12-[1-(4-hydroxy-3-methoxycyclohexyl)propan-2-yl]-20,31-dimethoxy-15,18,22,24,30,36-hexamethyl-11,17,37-trioxa-4-azatetracyclo[31.3.1.0⁴,⁹.0¹⁶,¹⁸]heptatriaconta-25,27,29-triene-2,3,10,14,21-pentone → [(1R,25E,27E,29Z)-1-hydroxy-12-[1-(4-hydroxy-3-methoxycyclohexyl)propan-2-yl]-20,31-dimethoxy-15,18,22,24,30,36-hexamethyl-2,3,10,14,21-pentaoxo-11,17,37-trioxa-4-azatetracyclo[31.3.1.0⁴,⁹.0¹⁶,¹⁸]heptatriaconta-25,27,29-trien-19-yl]oxidanesulfonic acid details
(1R,16Z,24E,26E,28Z)-1,18-dihydroxy-12-[1-(4-hydroxy-3-methoxycyclohexyl)propan-2-yl]-19,30-dimethoxy-15,17,21,23,29,35-hexamethyl-11,36-dioxa-4λ⁵-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraene-2,3,4,10,14,20-hexone → (4-{2-[(1R,16Z,24E,26E,28Z)-1,18-dihydroxy-19,30-dimethoxy-15,17,21,23,29,35-hexamethyl-2,3,4,10,14,20-hexaoxo-11,36-dioxa-4λ⁵-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraen-12-yl]propyl}-2-methoxycyclohexyl)oxidanesulfonic acid details
(1R,16Z,24E,26E,28Z)-1,18-dihydroxy-12-[1-(4-hydroxy-3-methoxycyclohexyl)propan-2-yl]-19,30-dimethoxy-15,17,21,23,29,35-hexamethyl-11,36-dioxa-4λ⁵-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraene-2,3,4,10,14,20-hexone → [(1R,16Z,24E,26E,28Z)-1-hydroxy-12-[1-(4-hydroxy-3-methoxycyclohexyl)propan-2-yl]-19,30-dimethoxy-15,17,21,23,29,35-hexamethyl-2,3,4,10,14,20-hexaoxo-11,36-dioxa-4λ⁵-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraen-18-yl]oxidanesulfonic acid details
(1R,16Z,24E,26E,28Z)-1,18-dihydroxy-12-[1-(4-hydroxy-3-methoxycyclohexyl)propan-2-yl]-19,30-dimethoxy-15,17,21,23,29-pentamethyl-35-methylidene-11,36-dioxa-4-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraene-2,3,10,14,20-pentone → (4-{2-[(1R,16Z,24E,26E,28Z)-1,18-dihydroxy-19,30-dimethoxy-15,17,21,23,29-pentamethyl-35-methylidene-2,3,10,14,20-pentaoxo-11,36-dioxa-4-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraen-12-yl]propyl}-2-methoxycyclohexyl)oxidanesulfonic acid details
(1R,16Z,24E,26E,28Z)-1,18-dihydroxy-12-[1-(4-hydroxy-3-methoxycyclohexyl)propan-2-yl]-19,30-dimethoxy-15,17,21,29,35-pentamethyl-23-methylidene-11,36-dioxa-4-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraene-2,3,10,14,20-pentone → (4-{2-[(1R,16Z,24E,26E,28Z)-1,18-dihydroxy-19,30-dimethoxy-15,17,21,29,35-pentamethyl-23-methylidene-2,3,10,14,20-pentaoxo-11,36-dioxa-4-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraen-12-yl]propyl}-2-methoxycyclohexyl)oxidanesulfonic acid details
(1R,16Z,24E,26E,28Z)-1,18-dihydroxy-12-[1-(4-hydroxy-3-methoxycyclohexyl)propan-2-yl]-19,30-dimethoxy-15,17,23,29,35-pentamethyl-21-methylidene-11,36-dioxa-4-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraene-2,3,10,14,20-pentone → (4-{2-[(1R,16Z,24E,26E,28Z)-1,18-dihydroxy-19,30-dimethoxy-15,17,23,29,35-pentamethyl-21-methylidene-2,3,10,14,20-pentaoxo-11,36-dioxa-4-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraen-12-yl]propyl}-2-methoxycyclohexyl)oxidanesulfonic acid details
(1R,16Z,24E,26E,28Z)-1,18-dihydroxy-12-[1-(4-hydroxy-3-methoxycyclohexyl)propan-2-yl]-19,30-dimethoxy-17,21,23,29,35-pentamethyl-15-methylidene-11,36-dioxa-4-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraene-2,3,10,14,20-pentone → (4-{2-[(1R,16Z,24E,26E,28Z)-1,18-dihydroxy-19,30-dimethoxy-17,21,23,29,35-pentamethyl-15-methylidene-2,3,10,14,20-pentaoxo-11,36-dioxa-4-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraen-12-yl]propyl}-2-methoxycyclohexyl)oxidanesulfonic acid details
(1R,16Z,24E,26E,28Z)-1,18-dihydroxy-12-[3-(4-hydroxy-3-methoxycyclohexyl)prop-1-en-2-yl]-19,30-dimethoxy-15,17,21,23,29,35-hexamethyl-11,36-dioxa-4-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraene-2,3,10,14,20-pentone → (4-{2-[(1R,16Z,24E,26E,28Z)-1,18-dihydroxy-19,30-dimethoxy-15,17,21,23,29,35-hexamethyl-2,3,10,14,20-pentaoxo-11,36-dioxa-4-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraen-12-yl]prop-2-en-1-yl}-2-methoxycyclohexyl)oxidanesulfonic acid details
(1R,16Z,24E,26E,28Z)-1,18-dihydroxy-12-[3-(4-hydroxy-3-methoxycyclohexyl)prop-1-en-2-yl]-19,30-dimethoxy-15,17,21,23,29,35-hexamethyl-11,36-dioxa-4-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraene-2,3,10,14,20-pentone → [(1R,16Z,24E,26E,28Z)-1-hydroxy-12-[3-(4-hydroxy-3-methoxycyclohexyl)prop-1-en-2-yl]-19,30-dimethoxy-15,17,21,23,29,35-hexamethyl-2,3,10,14,20-pentaoxo-11,36-dioxa-4-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraen-18-yl]oxidanesulfonic acid details
(1R,16Z,24E,26E,28Z)-1,13,18-trihydroxy-12-[1-(4-hydroxy-3-methoxycyclohexyl)propan-2-yl]-19,30-dimethoxy-15,17,21,23,29,35-hexamethyl-11,36-dioxa-4-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraene-2,3,10,14,20-pentone → [(1R,16Z,24E,26E,28Z)-1,18-dihydroxy-12-[1-(4-hydroxy-3-methoxycyclohexyl)propan-2-yl]-19,30-dimethoxy-15,17,21,23,29,35-hexamethyl-2,3,10,14,20-pentaoxo-11,36-dioxa-4-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraen-13-yl]oxidanesulfonic acid details
(1R,16Z,24E,26E,28Z)-1,13,18-trihydroxy-12-[1-(4-hydroxy-3-methoxycyclohexyl)propan-2-yl]-19,30-dimethoxy-15,17,21,23,29,35-hexamethyl-11,36-dioxa-4-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraene-2,3,10,14,20-pentone → (2-methoxy-4-{2-[(1R,16Z,24E,26E,28Z)-1,13,18-trihydroxy-19,30-dimethoxy-15,17,21,23,29,35-hexamethyl-2,3,10,14,20-pentaoxo-11,36-dioxa-4-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraen-12-yl]propyl}cyclohexyl)oxidanesulfonic acid details
(1R,16Z,24E,26E,28Z)-1,13,18-trihydroxy-12-[1-(4-hydroxy-3-methoxycyclohexyl)propan-2-yl]-19,30-dimethoxy-15,17,21,23,29,35-hexamethyl-11,36-dioxa-4-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraene-2,3,10,14,20-pentone → [(1R,16Z,24E,26E,28Z)-1,13-dihydroxy-12-[1-(4-hydroxy-3-methoxycyclohexyl)propan-2-yl]-19,30-dimethoxy-15,17,21,23,29,35-hexamethyl-2,3,10,14,20-pentaoxo-11,36-dioxa-4-azatricyclo[30.3.1.0⁴,⁹]hexatriaconta-16,24,26,28-tetraen-18-yl]oxidanesulfonic acid details
GO Classification
Biological Process
steroid metabolic process
xenobiotic metabolic process
3'-phosphoadenosine 5'-phosphosulfate metabolic process
sulfate assimilation
Cellular Component
cytosol
endoplasmic reticulum
nucleus
Function
catalytic activity
transferase activity
transferase activity, transferring sulfur-containing groups
sulfotransferase activity
Molecular Function
steroid sulfotransferase activity
alcohol sulfotransferase activity
Cellular Location
  1. Cytoplasm
Gene Properties
Chromosome Location 19
Locus 19q13.3
SNPs SULT2B1
Gene Sequence
>1098 bp
ATGGACGGGCCCGCCGAGCCCCAGATCCCGGGCTTGTGGGACACCTATGAAGATGACATC
TCGGAAATCAGCCAGAAGTTGCCAGGTGAATACTTCCGGTACAAGGGCGTCCCCTTCCCC
GTCGGCCTGTACTCGCTCGAGAGCATCAGCTTGGCGGAGAACACCCAAGATGTGCGGGAC
GACGACATCTTTATCATCACCTACCCCAAGTCAGGCACGACCTGGATGATCGAGATCATC
TGCTTAATCCTGAAGGAAGGGGATCCATCCTGGATCCGCTCCGTGCCCATCTGGGAGCGG
GCACCCTGGTGTGAGACCATTGTGGGTGCCTTCAGCCTCCCGGACCAGTACAGCCCCCGC
CTCATGAGCTCCCATCTTCCCATCCAGATCTTCACCAAGGCCTTCTTCAGCTCCAAGGCC
AAGGTGATCTACATGGGCCGCAACCCCCGGGACGTTGTGGTCTCCCTCTATCATTACTCC
AAGATCGCCGGGCAGTTAAAGGACCCGGGCACACCCGACCAGTTCCTGAGGGACTTCCTC
AAAGGCGAAGTGCAGTTTGGCTCCTGGTTCGACCACATTAAGGGCTGGCTTCGGATGAAG
GGCAAAGACAACTTCCTATTTATCACCTACGAGGAGCTGCAGCAGGACTTACAGGGCTCC
GTGGAGCGCATCTGTGGGTTCCTGGGCCGTCCGCTGGGCAAGGAGGCACTGGGCTCCGTC
GTGGCACACTCAACCTTCAGCGCCATGAAGGCCAACACCATGTCCAACTACACGCTGCTG
CCTCCCAGCCTGCTGGACCACCGTCGCGGGGCCTTCCTCCGGAAAGGGGTCTGCGGCGAC
TGGAAGAACCACTTCACGGTGGCCCAGAGCGAAGCCTTCGATCGTGCCTACCGCAAGCAG
ATGCGGGGGATGCCGACCTTCCCCTGGGATGAAGACCCGGAGGAGGACGGCAGCCCAGAT
CCTGAGCCCAGCCCTGAGCCTGAGCCCAAGCCCAGCCTTGAGCCCAACACCAGCCTGGAG
CGTGAGCCCAGACCCAACTCCAGCCCCAGCCCCAGCCCCGGCCAGGCCTCTGAGACCCCG
CACCCACGACCCTCATAA
Protein Properties
Number of Residues 365
Molecular Weight 39598.595
Theoretical pI 6.547
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Sulfotransferase family cytosolic 2B member 1
MDGPAEPQIPGLWDTYEDDISEISQKLPGEYFRYKGVPFPVGLYSLESISLAENTQDVRD
DDIFIITYPKSGTTWMIEIICLILKEGDPSWIRSVPIWERAPWCETIVGAFSLPDQYSPR
LMSSHLPIQIFTKAFFSSKAKVIYMGRNPRDVVVSLYHYSKIAGQLKDPGTPDQFLRDFL
KGEVQFGSWFDHIKGWLRMKGKDNFLFITYEELQQDLQGSVERICGFLGRPLGKEALGSV
VAHSTFSAMKANTMSNYTLLPPSLLDHRRGAFLRKGVCGDWKNHFTVAQSEAFDRAYRKQ
MRGMPTFPWDEDPEEDGSPDPEPSPEPEPKPSLEPNTSLEREPRPNSSPSPSPGQASETP
HPRPS
GenBank ID Protein 31563386
UniProtKB/Swiss-Prot ID O00204
UniProtKB/Swiss-Prot Entry Name ST2B1_HUMAN
PDB IDs
GenBank Gene ID NM_177973.1
GeneCard ID SULT2B1
GenAtlas ID SULT2B1
HGNC ID HGNC:11459
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Grimwood J, Gordon LA, Olsen A, Terry A, Schmutz J, Lamerdin J, Hellsten U, Goodstein D, Couronne O, Tran-Gyamfi M, Aerts A, Altherr M, Ashworth L, Bajorek E, Black S, Branscomb E, Caenepeel S, Carrano A, Caoile C, Chan YM, Christensen M, Cleland CA, Copeland A, Dalin E, Dehal P, Denys M, Detter JC, Escobar J, Flowers D, Fotopulos D, Garcia C, Georgescu AM, Glavina T, Gomez M, Gonzales E, Groza M, Hammon N, Hawkins T, Haydu L, Ho I, Huang W, Israni S, Jett J, Kadner K, Kimball H, Kobayashi A, Larionov V, Leem SH, Lopez F, Lou Y, Lowry S, Malfatti S, Martinez D, McCready P, Medina C, Morgan J, Nelson K, Nolan M, Ovcharenko I, Pitluck S, Pollard M, Popkie AP, Predki P, Quan G, Ramirez L, Rash S, Retterer J, Rodriguez A, Rogers S, Salamov A, Salazar A, She X, Smith D, Slezak T, Solovyev V, Thayer N, Tice H, Tsai M, Ustaszewska A, Vo N, Wagner M, Wheeler J, Wu K, Xie G, Yang J, Dubchak I, Furey TS, DeJong P, Dickson M, Gordon D, Eichler EE, Pennacchio LA, Richardson P, Stubbs L, Rokhsar DS, Myers RM, Rubin EM, Lucas SM: The DNA sequence and biology of human chromosome 19. Nature. 2004 Apr 1;428(6982):529-35. [PubMed:15057824 ]
  3. Her C, Wood TC, Eichler EE, Mohrenweiser HW, Ramagli LS, Siciliano MJ, Weinshilboum RM: Human hydroxysteroid sulfotransferase SULT2B1: two enzymes encoded by a single chromosome 19 gene. Genomics. 1998 Nov 1;53(3):284-95. [PubMed:9799594 ]
  4. Fuda H, Lee YC, Shimizu C, Javitt NB, Strott CA: Mutational analysis of human hydroxysteroid sulfotransferase SULT2B1 isoforms reveals that exon 1B of the SULT2B1 gene produces cholesterol sulfotransferase, whereas exon 1A yields pregnenolone sulfotransferase. J Biol Chem. 2002 Sep 27;277(39):36161-6. Epub 2002 Jul 26. [PubMed:12145317 ]
  5. Lee KA, Fuda H, Lee YC, Negishi M, Strott CA, Pedersen LC: Crystal structure of human cholesterol sulfotransferase (SULT2B1b) in the presence of pregnenolone and 3'-phosphoadenosine 5'-phosphate. Rationale for specificity differences between prototypical SULT2A1 and the SULT2BG1 isoforms. J Biol Chem. 2003 Nov 7;278(45):44593-9. Epub 2003 Aug 14. [PubMed:12923182 ]