You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP00415
Secondary Accession Numbers
  • 5652
Name Indolethylamine N-methyltransferase
Synonyms
  1. Amine N-methyltransferase
  2. Aromatic alkylamine N-methyltransferase
  3. Arylamine N-methyltransferase
  4. Indolamine N-methyltransferase
  5. Thioether S-methyltransferase
  6. TEMT
Gene Name INMT
Protein Type Unknown
Biological Properties
General Function Involved in methyltransferase activity
Specific Function Functions as thioether S-methyltransferase and is active with a variety of thioethers and the corresponding selenium and tellurium compounds, including 3-methylthiopropionaldehyde, dimethyl selenide, dimethyl telluride, 2-methylthioethylamine, 2-methylthioethanol, methyl-n-propyl sulfide and diethyl sulfide. Plays an important role in the detoxification of selenium compounds (By similarity). Catalyzes the N-methylation of tryptamine and structurally related compounds.
Pathways
  • Selenocompound metabolism
  • Tryptophan Metabolism
  • Tryptophan metabolism
Reactions
S-Adenosylmethionine + an amine → S-Adenosylhomocysteine + a methylated amine details
S-Adenosylmethionine + Dimethylsulfide → S-Adenosylhomocysteine + Trimethyl sulfonium details
S-Adenosylmethionine + Tryptamine → S-Adenosylhomocysteine + N-Methyltryptamine details
S-Adenosylmethionine + Serotonin → S-Adenosylhomocysteine + N-Methylserotonin details
S-Adenosylmethionine + Dimethyl selenide → S-Adenosylhomocysteine + Trimethylselenonium details
2-(1-{[(1-{3-[(E)-2-(7-chloroquinolin-2-yl)ethenyl]phenyl}-3-hydroxy-3-[2-(2-hydroxypropan-2-yl)phenyl]propyl)sulfanyl]methyl}cyclopropyl)acetic acid → {[1-(carboxymethyl)cyclopropyl]methyl}(1-{3-[(E)-2-(7-chloroquinolin-2-yl)ethenyl]phenyl}-3-hydroxy-3-[2-(2-hydroxypropan-2-yl)phenyl]propyl)methylsulfanium details
2-(1-{[(1-{3-[(E)-2-(7-chloro-6-hydroxyquinolin-2-yl)ethenyl]phenyl}-3-[2-(2-hydroxypropan-2-yl)phenyl]propyl)sulfanyl]methyl}cyclopropyl)acetic acid → {[1-(carboxymethyl)cyclopropyl]methyl}(1-{3-[(E)-2-(7-chloro-6-hydroxyquinolin-2-yl)ethenyl]phenyl}-3-[2-(2-hydroxypropan-2-yl)phenyl]propyl)methylsulfanium details
2-(1-{[(1-{3-[(E)-2-(7-chloroquinolin-2-yl)ethenyl]-2-hydroxyphenyl}-3-[2-(2-hydroxypropan-2-yl)phenyl]propyl)sulfanyl]methyl}cyclopropyl)acetic acid → {[1-(carboxymethyl)cyclopropyl]methyl}(1-{3-[2-(7-chloroquinolin-2-yl)ethenyl]-2-hydroxyphenyl}-3-[2-(2-hydroxypropan-2-yl)phenyl]propyl)methylsulfanium details
2-(1-{[(1-{3-[(E)-2-(7-chloroquinolin-2-yl)ethenyl]-4-hydroxyphenyl}-3-[2-(2-hydroxypropan-2-yl)phenyl]propyl)sulfanyl]methyl}cyclopropyl)acetic acid → {[1-(carboxymethyl)cyclopropyl]methyl}(1-{3-[2-(7-chloroquinolin-2-yl)ethenyl]-4-hydroxyphenyl}-3-[2-(2-hydroxypropan-2-yl)phenyl]propyl)methylsulfanium details
2-(1-{[(1-{5-[(E)-2-(7-chloroquinolin-2-yl)ethenyl]-2-hydroxyphenyl}-3-[2-(2-hydroxypropan-2-yl)phenyl]propyl)sulfanyl]methyl}cyclopropyl)acetic acid → {[1-(carboxymethyl)cyclopropyl]methyl}(1-{5-[2-(7-chloroquinolin-2-yl)ethenyl]-2-hydroxyphenyl}-3-[2-(2-hydroxypropan-2-yl)phenyl]propyl)methylsulfanium details
2-(1-{[(1-{3-[3-(7-chloroquinolin-2-yl)oxiran-2-yl]phenyl}-3-[2-(2-hydroxypropan-2-yl)phenyl]propyl)sulfanyl]methyl}cyclopropyl)acetic acid → {[1-(carboxymethyl)cyclopropyl]methyl}(1-{3-[3-(7-chloroquinolin-2-yl)oxiran-2-yl]phenyl}-3-[2-(2-hydroxypropan-2-yl)phenyl]propyl)methylsulfanium details
2-(1-{[(1-{3-[(E)-2-(7-chloro-8-hydroxyquinolin-2-yl)ethenyl]phenyl}-3-[2-(2-hydroxypropan-2-yl)phenyl]propyl)sulfanyl]methyl}cyclopropyl)acetic acid → {[1-(carboxymethyl)cyclopropyl]methyl}(1-{3-[(E)-2-(7-chloro-8-hydroxyquinolin-2-yl)ethenyl]phenyl}-3-[2-(2-hydroxypropan-2-yl)phenyl]propyl)methylsulfanium details
2-(1-{[(1-{3-[(E)-2-(7-chloro-5-hydroxyquinolin-2-yl)ethenyl]phenyl}-3-[2-(2-hydroxypropan-2-yl)phenyl]propyl)sulfanyl]methyl}cyclopropyl)acetic acid → {[1-(carboxymethyl)cyclopropyl]methyl}(1-{3-[(E)-2-(7-chloro-5-hydroxyquinolin-2-yl)ethenyl]phenyl}-3-[2-(2-hydroxypropan-2-yl)phenyl]propyl)methylsulfanium details
2-(1-{[(1-{3-[(E)-2-(7-chloroquinolin-2-yl)ethenyl]phenyl}-3-[2-(1,2-dihydroxypropan-2-yl)phenyl]propyl)sulfanyl]methyl}cyclopropyl)acetic acid → {[1-(carboxymethyl)cyclopropyl]methyl}(1-{3-[(E)-2-(7-chloroquinolin-2-yl)ethenyl]phenyl}-3-[2-(1,2-dihydroxypropan-2-yl)phenyl]propyl)methylsulfanium details
2-(1-{[(1-{3-[(E)-2-(7-chloroquinolin-2-yl)ethenyl]phenyl}-3-[2-(2-hydroxypropan-2-yl)phenyl]propyl)sulfanyl]methyl}cyclopropyl)-2-hydroxyacetic acid → ({1-[carboxy(hydroxy)methyl]cyclopropyl}methyl)(1-{3-[(E)-2-(7-chloroquinolin-2-yl)ethenyl]phenyl}-3-[2-(2-hydroxypropan-2-yl)phenyl]propyl)methylsulfanium details
2-(1-{[(1-{3-[(E)-2-(7-chloroquinolin-2-yl)ethenyl]phenyl}-3-[2-(2-hydroxypropan-2-yl)phenyl]propyl)sulfanyl]methyl}-2-hydroxycyclopropyl)acetic acid → {[1-(carboxymethyl)-2-hydroxycyclopropyl]methyl}(1-{3-[(E)-2-(7-chloroquinolin-2-yl)ethenyl]phenyl}-3-[2-(2-hydroxypropan-2-yl)phenyl]propyl)methylsulfanium details
1-{[(1-{3-[(E)-2-(7-chloro-6-hydroxyquinolin-2-yl)ethenyl]phenyl}-3-[2-(2-hydroxypropan-2-yl)phenyl]propyl)sulfanyl]methyl}cyclopropane-1-carboxylic acid → [(1-carboxycyclopropyl)methyl](1-{3-[(E)-2-(7-chloro-6-hydroxyquinolin-2-yl)ethenyl]phenyl}-3-[2-(2-hydroxypropan-2-yl)phenyl]propyl)methylsulfanium details
1-{[(1-{3-[(E)-2-(7-chloro-8-hydroxyquinolin-2-yl)ethenyl]phenyl}-3-[2-(2-hydroxypropan-2-yl)phenyl]propyl)sulfanyl]methyl}cyclopropane-1-carboxylic acid → [(1-carboxycyclopropyl)methyl](1-{3-[(E)-2-(7-chloro-8-hydroxyquinolin-2-yl)ethenyl]phenyl}-3-[2-(2-hydroxypropan-2-yl)phenyl]propyl)methylsulfanium details
1-{[(1-{3-[(E)-2-(7-chloro-5-hydroxyquinolin-2-yl)ethenyl]phenyl}-3-[2-(2-hydroxypropan-2-yl)phenyl]propyl)sulfanyl]methyl}cyclopropane-1-carboxylic acid → [(1-carboxycyclopropyl)methyl](1-{3-[(E)-2-(7-chloro-5-hydroxyquinolin-2-yl)ethenyl]phenyl}-3-[2-(2-hydroxypropan-2-yl)phenyl]propyl)methylsulfanium details
GO Classification
Biological Process
amine metabolic process
response to toxin
Cellular Component
cytosol
Function
catalytic activity
transferase activity
transferase activity, transferring one-carbon groups
methyltransferase activity
Molecular Function
amine N-methyltransferase activity
thioether S-methyltransferase activity
Cellular Location
  1. Cytoplasm
Gene Properties
Chromosome Location 7
Locus 7p14.3
SNPs INMT
Gene Sequence
>792 bp
ATGAAGGGTGGCTTCACTGGGGGTGATGAGTACCAGAAGCACTTCCTGCCCAGGGACTAC
TTGGCTACTTACTACAGCTTCGATGGCAGCCCCTCACCCGAGGCCGAGATGCTGAAGTTT
AACTTGGAATGTCTCCACAAGACCTTCGGCCCTGGAGGCCTCCAAGGGGACACGCTGATT
GACATTGGCTCAGGTCCTACCATCTACCAAGTTCTTGCTGCCTGTGATTCCTTCCAAGAC
ATCACTCTCTCCGACTTTACCGACCGCAACCGGGAGGAGCTGGAAAAGTGGCTGAAGAAG
GAGCCGGGGGCCTATGACTGGACCCCAGCGGTGAAATTCGCCTGTGAGCTGGAAGGAAAC
AGCGGCCGATGGGAGGAGAAGGAGGAGAAGCTGCGGGCAGCGGTGAAGCGGGTGCTCAAG
TGCGATGTCCACCTGGGCAACCCGCTGGCCCCGGCTGTGTTGCCTCTCGCCGACTGTGTG
CTCACCCTGCTGGCCATGGAGTGTGCCTGCTGTAGCCTTGATGCCTACCGCGCTGCCCTG
TGCAACCTTGCCTCACTGCTCAAGCCGGGTGGCCACCTGGTGACCACTGTCACGCTTCGG
CTCCCGTCCTACATGGTGGGGAAGCGTGAATTTTCCTGCGTGGCCCTGGAGAAAGAGGAG
GTGGAGCAGGCTGTCCTGGATGCTGGCTTTGACATTGAACAGCTCCTACACAGTCCCCAG
AGCTACTCTGTCACCAATGCTGCCAACAATGGGGTCTGCTTCATTGTGGCTCGCAAGAAG
CCTGGGCCCTGA
Protein Properties
Number of Residues 263
Molecular Weight 28833.695
Theoretical pI 5.27
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Indolethylamine N-methyltransferase
MKGGFTGGDEYQKHFLPRDYLATYYSFDGSPSPEAEMLKFNLECLHKTFGPGGLQGDTLI
DIGSGPTIYQVLAACDSFQDITLSDFTDRNREELEKWLKKEPGAYDWTPAVKFACELEGN
SGRWEEKEEKLRAAVKRVLKCDVHLGNPLAPAVLPLADCVLTLLAMECACCSLDAYRAAL
CNLASLLKPGGHLVTTVTLRLPSYMVGKREFSCVALEKEEVEQAVLDAGFDIEQLLHSPQ
SYSVTNAANNGVCFIVARKKPGP
GenBank ID Protein 66933018
UniProtKB/Swiss-Prot ID O95050
UniProtKB/Swiss-Prot Entry Name INMT_HUMAN
PDB IDs
GenBank Gene ID NM_006774.4
GeneCard ID INMT
GenAtlas ID INMT
HGNC ID HGNC:6069
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Hillier LW, Fulton RS, Fulton LA, Graves TA, Pepin KH, Wagner-McPherson C, Layman D, Maas J, Jaeger S, Walker R, Wylie K, Sekhon M, Becker MC, O'Laughlin MD, Schaller ME, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Cordes M, Du H, Sun H, Edwards J, Bradshaw-Cordum H, Ali J, Andrews S, Isak A, Vanbrunt A, Nguyen C, Du F, Lamar B, Courtney L, Kalicki J, Ozersky P, Bielicki L, Scott K, Holmes A, Harkins R, Harris A, Strong CM, Hou S, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Leonard S, Rohlfing T, Rock SM, Tin-Wollam AM, Abbott A, Minx P, Maupin R, Strowmatt C, Latreille P, Miller N, Johnson D, Murray J, Woessner JP, Wendl MC, Yang SP, Schultz BR, Wallis JW, Spieth J, Bieri TA, Nelson JO, Berkowicz N, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Bedell JA, Mardis ER, Clifton SW, Chissoe SL, Marra MA, Raymond C, Haugen E, Gillett W, Zhou Y, James R, Phelps K, Iadanoto S, Bubb K, Simms E, Levy R, Clendenning J, Kaul R, Kent WJ, Furey TS, Baertsch RA, Brent MR, Keibler E, Flicek P, Bork P, Suyama M, Bailey JA, Portnoy ME, Torrents D, Chinwalla AT, Gish WR, Eddy SR, McPherson JD, Olson MV, Eichler EE, Green ED, Waterston RH, Wilson RK: The DNA sequence of human chromosome 7. Nature. 2003 Jul 10;424(6945):157-64. [PubMed:12853948 ]
  3. Thompson MA, Moon E, Kim UJ, Xu J, Siciliano MJ, Weinshilboum RM: Human indolethylamine N-methyltransferase: cDNA cloning and expression, gene cloning, and chromosomal localization. Genomics. 1999 Nov 1;61(3):285-97. [PubMed:10552930 ]
  4. Kitano T, Liu YH, Ueda S, Saitou N: Human-specific amino acid changes found in 103 protein-coding genes. Mol Biol Evol. 2004 May;21(5):936-44. Epub 2004 Mar 10. [PubMed:15014171 ]