You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP00446
Secondary Accession Numbers
  • 5684
  • HMDBP05632
Name Solute carrier organic anion transporter family member 1B3
Synonyms
  1. LST-2
  2. Liver-specific organic anion transporter 2
  3. OATP-8
  4. Organic anion transporter 8
  5. Organic anion-transporting polypeptide 8
  6. Solute carrier family 21 member 8
Gene Name SLCO1B3
Protein Type Transporter
Biological Properties
General Function Involved in transporter activity
Specific Function Mediates the Na(+)-independent transport of organic anions such as 17-beta-glucuronosyl estradiol, taurocholate, triiodothyronine (T3), leukotriene C4, dehydroepiandrosterone sulfate (DHEAS), methotrexate and sulfobromophthalein (BSP)
Pathways
  • Docetaxel Action Pathway
  • Mycophenolic Acid Metabolism Pathway
  • Paclitaxel Action Pathway
Reactions Not Available
GO Classification
Component
membrane
cell part
Function
transporter activity
Process
establishment of localization
transport
Cellular Location
  1. Multi-pass membrane protein
  2. Multi-pass membrane protein
  3. Basal cell membrane
  4. Lateral cell membrane
Gene Properties
Chromosome Location Chromosome:1
Locus 12p12
SNPs SLCO1B3
Gene Sequence
>2109 bp
ATGGACCAACATCAACATTTGAATAAAACAGCAGAGTCAGCATCTTCAGAGAAAAAGAAA
ACAAGACGCTGCAATGGATTCAAGATGTTCTTGGCAGCCCTGTCATTCAGCTATATTGCT
AAAGCACTAGGTGGAATCATTATGAAAATTTCCATCACTCAAATAGAAAGGAGATTTGAC
ATATCCTCTTCTCTTGCTGGTTTAATTGATGGAAGCTTTGAAATTGGAAATTTGCTTGTG
ATTGTATTTGTAAGTTACTTTGGATCTAAACTACACAGACCGAAGTTAATTGGAATTGGT
TGTCTCCTTATGGGAACTGGAAGTATTTTGACATCTTTACCACATTTCTTCATGGGATAT
TATAGGTATTCTAAAGAAACCCATATTAATCCATCAGAAAATTCAACATCAAGTTTATCA
ACCTGTTTAATTAATCAAACCTTATCATTCAATGGAACATCACCTGAGATAGTAGAAAAA
GATTGTGTAAAGGAATCTGGGTCACACATGTGGATCTATGTCTTCATGGGGAATATGCTT
CGTGGCATAGGGGAAACCCCCATAGTACCATTGGGGATTTCATACATTGATGATTTTGCA
AAAGAAGGACATTCTTCCTTGTATTTAGGTAGTTTGAATGCAATAGGAATGATTGGTCCA
GTCATTGGCTTTGCACTGGGATCTCTGTTTGCTAAAATGTACGTGGATATTGGATATGTA
GATCTGAGCACTATCAGAATAACTCCTAAGGACTCTCGTTGGGTTGGAGCTTGGTGGCTT
GGTTTCCTTGTGTCTGGACTATTTTCCATTATTTCTTCCATACCATTTTTTTTCTTGCCG
AAAAATCCAAATAAACCACAAAAAGAAAGAAAAATTTCACTATCATTGCATGTGCTGAAA
ACAAATGATGATAGAAATCAAACAGCTAATTTGACCAACCAAGGAAAAAATGTTACCAAA
AATGTGACTGGTTTTTTCCAGTCTTTGAAAAGCATCCTTACCAATCCCCTGTATGTTATA
TTTCTGCTTTTGACATTGTTACAAGTAAGCAGCTTTATTGGTTCTTTTACTTACGTCTTT
AAATATATGGAGCAACAGTACGGTCAGTCTGCATCTCATGCTAACTTTTTGTTGGGAATC
ATAACCATTCCTACGGTTGCAACTGGAATGTTTTTAGGAGGATTTATCATTAAAAAATTC
AAATTGTCTTTAGTTGGAATTGCCAAATTTTCATTTCTTACTTCGATGATATCCTTCTTG
TTTCAACTTCTATATTTCCCTCTAATCTGCGAAAGCAAATCAGTTGCCGGCCTAACCTTG
ACCTATGATGGAAATAATTCAGTGGCATCTCATGTAGATGTACCACTTTCTTATTGCAAC
TCAGAGTGCAATTGTGATGAAAGTCAGTGGGAACCAGTCTGTGGGAACAATGGAATAACT
TACCTGTCACCTTGTCTAGCAGGATGCAAATCCTCAAGTGGTATTAAAAAGCATACAGTG
TTTTATAACTGTAGTTGTGTGGAAGTAACTGGTCTCCAGAACAGAAATTACTCAGCACAC
TTGGGTGAATGCCCAAGAGATAATACTTGTACAAGGAAATTTTTCATCTATGTTGCAATT
CAAGTCATAAACTCTTTGTTCTCTGCAACAGGAGGTACCACATTTATCTTGTTGACTGTG
AAGATTGTTCAACCTGAATTGAAAGCACTTGCAATGGGTTTCCAGTCAATGGTTATAAGA
ACACTAGGAGGAATTCTAGCTCCAATATATTTTGGGGCTCTGATTGATAAAACATGTATG
AAGTGGTCCACCAACAGCTGTGGAGCACAAGGAGCTTGTAGGATATATAATTCCGTATTT
TTTGGAAGGGTCTACTTGGGCTTATCTATAGCTTTAAGATTCCCAGCACTTGTTTTATAT
ATTGTTTTCATTTTTGCTATGAAGAAAAAATTTCAAGGAAAAGATACCAAGGCATCGGAC
AATGAAAGAAAAGTAATGGATGAAGCAAACTTAGAATTCTTAAATAATGGTGAACATTTT
GTACCTTCTGCTGGAACAGATAGTAAAACATGTAATTTGGACATGCAAGACAATGCTGCT
GCCAACTAA
Protein Properties
Number of Residues 702
Molecular Weight 77402.2
Theoretical pI 8.95
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 30-50
  • 65-85
  • 97-117
  • 171-191
  • 207-227
  • 259-279
  • 336-356
  • 377-397
  • 410-430
  • 538-558
  • 575-595
  • 626-646
Protein Sequence
>Solute carrier organic anion transporter family member 1B3
MDQHQHLNKTAESASSEKKKTRRCNGFKMFLAALSFSYIAKALGGIIMKISITQIERRFD
ISSSLAGLIDGSFEIGNLLVIVFVSYFGSKLHRPKLIGIGCLLMGTGSILTSLPHFFMGY
YRYSKETHINPSENSTSSLSTCLINQTLSFNGTSPEIVEKDCVKESGSHMWIYVFMGNML
RGIGETPIVPLGISYIDDFAKEGHSSLYLGSLNAIGMIGPVIGFALGSLFAKMYVDIGYV
DLSTIRITPKDSRWVGAWWLGFLVSGLFSIISSIPFFFLPKNPNKPQKERKISLSLHVLK
TNDDRNQTANLTNQGKNVTKNVTGFFQSLKSILTNPLYVIFLLLTLLQVSSFIGSFTYVF
KYMEQQYGQSASHANFLLGIITIPTVATGMFLGGFIIKKFKLSLVGIAKFSFLTSMISFL
FQLLYFPLICESKSVAGLTLTYDGNNSVASHVDVPLSYCNSECNCDESQWEPVCGNNGIT
YLSPCLAGCKSSSGIKKHTVFYNCSCVEVTGLQNRNYSAHLGECPRDNTCTRKFFIYVAI
QVINSLFSATGGTTFILLTVKIVQPELKALAMGFQSMVIRTLGGILAPIYFGALIDKTCM
KWSTNSCGAQGACRIYNSVFFGRVYLGLSIALRFPALVLYIVFIFAMKKKFQGKDTKASD
NERKVMDEANLEFLNNGEHFVPSAGTDSKTCNLDMQDNAAAN
GenBank ID Protein 9187497
UniProtKB/Swiss-Prot ID Q9NPD5
UniProtKB/Swiss-Prot Entry Name SO1B3_HUMAN
PDB IDs Not Available
GenBank Gene ID AJ251506
GeneCard ID SLCO1B3
GenAtlas ID SLCO1B3
HGNC ID HGNC:10961
References
General References
  1. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. [PubMed:16959974 ]
  2. Konig J, Cui Y, Nies AT, Keppler D: Localization and genomic organization of a new hepatocellular organic anion transporting polypeptide. J Biol Chem. 2000 Jul 28;275(30):23161-8. [PubMed:10779507 ]
  3. Abe T, Unno M, Onogawa T, Tokui T, Kondo TN, Nakagomi R, Adachi H, Fujiwara K, Okabe M, Suzuki T, Nunoki K, Sato E, Kakyo M, Nishio T, Sugita J, Asano N, Tanemoto M, Seki M, Date F, Ono K, Kondo Y, Shiiba K, Suzuki M, Ohtani H, Shimosegawa T, Iinuma K, Nagura H, Ito S, Matsuno S: LST-2, a human liver-specific organic anion transporter, determines methotrexate sensitivity in gastrointestinal cancers. Gastroenterology. 2001 Jun;120(7):1689-99. [PubMed:11375950 ]