You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP00447
Secondary Accession Numbers
  • 5685
  • HMDBP05933
Name Estradiol 17-beta-dehydrogenase 2
Synonyms
  1. 17-beta-HSD 2
  2. 17-beta-hydroxysteroid dehydrogenase type 2
  3. 20 alpha-hydroxysteroid dehydrogenase
  4. 20-alpha-HSD
  5. E2DH
  6. Microsomal 17-beta-hydroxysteroid dehydrogenase
  7. Testosterone 17-beta-dehydrogenase
Gene Name HSD17B2
Protein Type Unknown
Biological Properties
General Function Involved in oxidoreductase activity
Specific Function Capable of catalyzing the interconversion of testosterone and androstenedione, as well as estradiol and estrone. Also has 20-alpha-HSD activity. Uses NADH while EDH17B3 uses NADPH.
Pathways
  • Steroid hormone biosynthesis
Reactions
Estradiol + NAD(P)(+) → Estrone + NAD(P)H details
Testosterone + NAD → Androstenedione + NADH details
Testosterone + NAD → Androstenedione + NADH + Hydrogen Ion details
Estradiol + NAD → Estrone + NADH + Hydrogen Ion details
Estradiol + NADP → Estrone + NADPH + Hydrogen Ion details
Estriol + NAD → 16b-Hydroxyestrone + NADH + Hydrogen Ion details
Estriol + NADP → 16b-Hydroxyestrone + NADPH + Hydrogen Ion details
11beta,17beta-Dihydroxy-4-androsten-3-one + NAD → 11b-Hydroxyandrost-4-ene-3,17-dione + NADH + Hydrogen Ion details
11beta,17beta-Dihydroxy-4-androsten-3-one + NADP → 11b-Hydroxyandrost-4-ene-3,17-dione + NADPH + Hydrogen Ion details
GO Classification
Biological Process
response to retinoic acid
bone development
cellular response to metal ion
androgen biosynthetic process
estrogen biosynthetic process
Cellular Component
endoplasmic reticulum membrane
integral to membrane
Function
binding
catalytic activity
oxidoreductase activity
Molecular Function
17-alpha,20-alpha-dihydroxypregn-4-en-3-one dehydrogenase activity
testosterone dehydrogenase (NAD+) activity
estradiol 17-beta-dehydrogenase activity
testosterone 17-beta-dehydrogenase (NAD+) activity
nucleotide binding
Process
metabolic process
oxidation reduction
Cellular Location
  1. Membrane
  2. Single-pass type II membrane protein (Potential)
Gene Properties
Chromosome Location 16
Locus 16q24.1-q24.2
SNPs HSD17B2
Gene Sequence
>1164 bp
ATGAGCACTTTCTTCTCGGACACAGCATGGATCTGCCTGGCTGTCCCCACAGTACTATGT
GGGACAGTATTTTGCAAATACAAGAAGAGCTCAGGGCAGCTGTGGAGCTGGATGGTCTGC
CTGGCAGGCCTCTGTGCAGTCTGCCTGCTCATCCTGTCCCCTTTTTGGGGCTTGATCCTC
TTCTCGGTGTCATGCTTCCTCATGTATACTTACTTATCTGGCCAAGAATTGTTACCTGTG
GATCAGAAGGCAGTCCTGGTGACAGGTGGTGATTGCGGGCTTGGCCATGCTTTGTGCAAG
TATCTGGATGAGCTGGGCTTCACGGTATTTGCCGGAGTTTTGAATGAAAATGGCCCAGGA
GCTGAGGAATTGCGAAGAACCTGCTCTCCGCGCCTCTCGGTGCTCCAAATGGACATCACG
AAGCCAGTGCAGATAAAAGATGCTTACAGCAAGGTTGCAGCAATGCTGCAGGACAGAGGA
CTGTGGGCTGTGATCAACAATGCTGGGGTGCTTGGCTTTCCAACTGATGGGGAGCTTCTT
CTTATGACTGACTACAAACAATGCATGGCCGTGAACTTCTTTGGAACTGTGGAGGTCACA
AAGACGTTTTTGCCTCTTCTTAGAAAATCCAAAGGGAGGCTGGTGAATGTCAGCAGCATG
GGAGGAGGGGCCCCAATGGAAAGGCTGGCATCTTATGGCTCATCAAAGGCGGCTGTGACC
ATGTTCTCATCAGTTATGAGACTGGAGCTTTCCAAGTGGGGAATTAAAGTTGCTTCCATC
CAACCTGGAGGCTTCCTAACAAATATCGCAGGCACCAGTGACAAGTGGGAAAAGCTGGAG
AAGGACATTCTGGACCACCTCCCCGCTGAGGTACAGGAAGACTACGGCCAGGACTACATC
TTAGCACAGCGGAATTTCCTCCTATTGATCAACTCGTTAGCCAGCAAGGACTTCTCTCCG
GTGCTGCGGGACATCCAGCATGCTATCTTGGCGAAGAGCCCTTTTGCCTATTACACGCCA
GGGAAAGGCGCTTACTTGTGGATCTGCCTTGCTCACTATTTGCCTATTGGCATATATGAT
TACTTTGCTAAAAGACATTTTGGCCAAGACAAGCCCATGCCCAGAGCTCTAAGAATGCCT
AACTACAAGAAAAAGGCCACCTAG
Protein Properties
Number of Residues 387
Molecular Weight 42784.75
Theoretical pI 8.5
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Estradiol 17-beta-dehydrogenase 2
MSTFFSDTAWICLAVPTVLCGTVFCKYKKSSGQLWSWMVCLAGLCAVCLLILSPFWGLIL
FSVSCFLMYTYLSGQELLPVDQKAVLVTGGDCGLGHALCKYLDELGFTVFAGVLNENGPG
AEELRRTCSPRLSVLQMDITKPVQIKDAYSKVAAMLQDRGLWAVINNAGVLGFPTDGELL
LMTDYKQCMAVNFFGTVEVTKTFLPLLRKSKGRLVNVSSMGGGAPMERLASYGSSKAAVT
MFSSVMRLELSKWGIKVASIQPGGFLTNIAGTSDKWEKLEKDILDHLPAEVQEDYGQDYI
LAQRNFLLLINSLASKDFSPVLRDIQHAILAKSPFAYYTPGKGAYLWICLAHYLPIGIYD
YFAKRHFGQDKPMPRALRMPNYKKKAT
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID P37059
UniProtKB/Swiss-Prot Entry Name DHB2_HUMAN
PDB IDs Not Available
GenBank Gene ID L11708
GeneCard ID HSD17B2
GenAtlas ID HSD17B2
HGNC ID HGNC:5211
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  4. Wu L, Einstein M, Geissler WM, Chan HK, Elliston KO, Andersson S: Expression cloning and characterization of human 17 beta-hydroxysteroid dehydrogenase type 2, a microsomal enzyme possessing 20 alpha-hydroxysteroid dehydrogenase activity. J Biol Chem. 1993 Jun 15;268(17):12964-9. [PubMed:8099587 ]
  5. Labrie Y, Durocher F, Lachance Y, Turgeon C, Simard J, Labrie C, Labrie F: The human type II 17 beta-hydroxysteroid dehydrogenase gene encodes two alternatively spliced mRNA species. DNA Cell Biol. 1995 Oct;14(10):849-61. [PubMed:7546291 ]