You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP00451
Secondary Accession Numbers
  • 5689
  • HMDBP05635
Name Solute carrier organic anion transporter family member 1C1
Synonyms
  1. OAT-RP-5
  2. OATP-14
  3. OATP-F
  4. OATPRP5
  5. Organic anion transporter F
  6. Organic anion transporter polypeptide-related protein 5
  7. Organic anion-transporting polypeptide 14
  8. Solute carrier family 21 member 14
Gene Name SLCO1C1
Protein Type Transporter
Biological Properties
General Function Involved in transporter activity
Specific Function Mediates the Na(+)-independent high affinity transport of organic anions such as the thyroid hormones thyroxine (T4) and rT3. Other potential substrates, such as triiodothyronine (T3), 17-beta-glucuronosyl estradiol, estrone-3-sulfate and sulfobromophthalein (BSP) are transported with much lower efficiency
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
Function
transporter activity
Process
establishment of localization
transport
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:1
Locus 12p12.2
SNPs SLCO1C1
Gene Sequence
>2139 bp
ATGGACACTTCATCCAAAGAAAATATCCAGTTGTTCTGCAAAACTTCAGTGCAACCTGTT
GGAAGGCCTTCTTTTAAAACAGAATATCCCTCCTCAGAAGAAAAGCAACCATGCTGTGGT
GAACTAAAGGTGTTCTTGTGTGCCTTGTCTTTTGTTTACTTTGCCAAAGCATTGGCAGAA
GGCTATCTGAAGAGCACCATCACTCAGATAGAGAGAAGGTTTGATATCCCTTCTTCACTG
GTGGGAGTTATTGATGGTAGTTTTGAAATTGGGAATCTCTTAGTTATAACATTTGTTAGC
TACTTTGGAGCCAAACTTCACAGGCCAAAAATAATTGGAGCAGGGTGTGTAATCATGGGA
GTTGGAACACTGCTCATTGCAATGCCTCAGTTCTTCATGGAGCAGTACAAATATGAGAGA
TATTCTCCTTCCTCCAATTCCACTCTCAGCATCTCTCCGTGTCTCCTAGAGTCAAGCAGT
CAATTACCAGTTTCAGTTATGGAAAAATCAAAATCCAAAATAAGTAACGAATGTGAAGTG
GACACTAGCTCTTCCATGTGGATTTATGTTTTCCTGGGCAATCTTCTTCGTGGAATAGGA
GAAACTCCCATTCAGCCTTTGGGCATTGCCTACCTGGATGATTTTGCCAGTGAAGACAAT
GCAGCTTTCTATATTGGGTGTGTGCAGACGGTTGCAATTATAGGACCAATCTTTGGTTTC
CTGTTAGGCTCATTATGTGCCAAACTATATGTTGACATTGGCTTTGTAAACCTAGATCAC
ATAACCATTACCCCAAAAGATCCCCAGTGGGTAGGAGCCTGGTGGCTTGGCTATCTAATA
GCAGGAATCATAAGTCTTCTTGCAGCTGTGCCTTTCTGGTATTTACCAAAGAGTTTACCA
AGATCCCAAAGTAGAGAGGATTCTAATTCTTCCTCTGAGAAATCCAAGTTTATTATAGAT
GATCACACAGACTACCAAACACCCCAGGGAGAAAATGCAAAAATAATGGAAATGGCAAGA
GATTTTCTTCCATCACTGAAGAATCTTTTTGGAAACCCAGTATACTTCCTATATTTATGT
ACAAGCACTGTTCAGTTCAATTCTCTGTTCGGCATGGTGACGTACAAACCAAAGTACATT
GAGCAGCAGTATGGACAGTCATCCTCCAGGGCCAACTTTGTGATCGGGCTCATCAACATT
CCAGCAGTGGCCCTTGGAATATTCTCTGGGGGGATAGTTATGAAAAAATTCAGAATCAGT
GTGTGTGGAGCTGCAAAACTCTACTTGGGATCATCTGTCTTTGGTTACCTCCTATTTCTT
TCCCTGTTTGCACTGGGCTGTGAAAATTCTGATGTGGCAGGACTAACTGTCTCCTACCAA
GGAACCAAACCTGTCTCTTATCATGAACGAGCTCTCTTTTCAGATTGCAACTCAAGATGC
AAATGTTCAGAGACAAAATGGGAACCCATGTGCGGTGAAAATGGAATCACATATGTATCA
GCTTGTCTTGCTGGTTGTCAAACCTCCAACAGGAGTGGAAAAAATATTATATTTTACAAC
TGCACTTGTGTGGGAATTGCAGCTTCTAAATCCGGAAATTCCTCAGGCATAGTGGGAAGA
TGTCAGAAAGACAATGGATGTCCCCAAATGTTTCTGTATTTCCTTGTAATTTCAGTCATC
ACATCCTATACTTTATCCCTAGGTGGCATACCTGGATACATATTACTTCTGAGGTGCATT
AAGCCACAGCTTAAGTCTTTTGCCTTGGGTATCTACACATTAGCAATAAGAGTTCTTGCA
GGAATCCCAGCTCCAGTGTATTTTGGAGTTTTGATTGATACTTCATGCCTCAAATGGGGA
TTTAAAAGATGTGGAAGTAGAGGATCATGCAGATTATATGATTCAAATGTCTTCAGACAT
ATATATCTGGGACTAACTGTGATACTGGGCACAGTGTCAATTCTCCTAAGCATTGCAGTA
CTTTTCATTTTAAAGAAAAATTATGTTTCAAAACACAGAAGTTTTATAACCAAGAGAGAA
AGAACAATGGTGTCTACAAGATTCCAAAAGGAAAATTACACTACAAGTGATCATCTGCTA
CAACCCAACTACTGGCCAGGCAAGGAAACTCAACTTTAG
Protein Properties
Number of Residues 712
Molecular Weight 78695.6
Theoretical pI 8.59
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 80-100
  • 111-131
  • 222-242
  • 270-290
  • 353-373
  • 393-413
  • 427-447
  • 550-570
  • 592-612
  • 643-663
Protein Sequence
>Solute carrier organic anion transporter family member 1C1
MDTSSKENIQLFCKTSVQPVGRPSFKTEYPSSEEKQPCCGELKVFLCALSFVYFAKALAE
GYLKSTITQIERRFDIPSSLVGVIDGSFEIGNLLVITFVSYFGAKLHRPKIIGAGCVIMG
VGTLLIAMPQFFMEQYKYERYSPSSNSTLSISPCLLESSSQLPVSVMEKSKSKISNECEV
DTSSSMWIYVFLGNLLRGIGETPIQPLGIAYLDDFASEDNAAFYIGCVQTVAIIGPIFGF
LLGSLCAKLYVDIGFVNLDHITITPKDPQWVGAWWLGYLIAGIISLLAAVPFWYLPKSLP
RSQSREDSNSSSEKSKFIIDDHTDYQTPQGENAKIMEMARDFLPSLKNLFGNPVYFLYLC
TSTVQFNSLFGMVTYKPKYIEQQYGQSSSRANFVIGLINIPAVALGIFSGGIVMKKFRIS
VCGAAKLYLGSSVFGYLLFLSLFALGCENSDVAGLTVSYQGTKPVSYHERALFSDCNSRC
KCSETKWEPMCGENGITYVSACLAGCQTSNRSGKNIIFYNCTCVGIAASKSGNSSGIVGR
CQKDNGCPQMFLYFLVISVITSYTLSLGGIPGYILLLRCIKPQLKSFALGIYTLAIRVLA
GIPAPVYFGVLIDTSCLKWGFKRCGSRGSCRLYDSNVFRHIYLGLTVILGTVSILLSIAV
LFILKKNYVSKHRSFITKRERTMVSTRFQKENYTTSDHLLQPNYWPGKETQL
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q9NYB5
UniProtKB/Swiss-Prot Entry Name SO1C1_HUMAN
PDB IDs Not Available
GenBank Gene ID AF260704
GeneCard ID SLCO1C1
GenAtlas ID SLCO1C1
HGNC ID HGNC:13819
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Pizzagalli F, Hagenbuch B, Stieger B, Klenk U, Folkers G, Meier PJ: Identification of a novel human organic anion transporting polypeptide as a high affinity thyroxine transporter. Mol Endocrinol. 2002 Oct;16(10):2283-96. [PubMed:12351693 ]