You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP00453
Secondary Accession Numbers
  • 5691
  • HMDBP07056
Name Estradiol 17-beta-dehydrogenase 8
Synonyms
  1. 17-beta-HSD 8
  2. 17-beta-hydroxysteroid dehydrogenase 8
  3. 3-oxoacyl-[acyl-carrier-protein] reductase
  4. Ke-6
  5. Protein Ke6
  6. Really interesting new gene 2 protein
  7. Testosterone 17-beta-dehydrogenase 8
Gene Name HSD17B8
Protein Type Unknown
Biological Properties
General Function Involved in oxidoreductase activity
Specific Function NAD-dependent 17-beta-hydroxysteroid dehydrogenase with highest activity towards estradiol. Has very low activity towards testosterone. The heteroteramer with CBR4 has NADH-dependent 3-ketoacyl-acyl carrier protein reductase activity. May play a role in biosynthesis of fatty acids in mitochondria.
Pathways
  • estrogen biosynthesis
  • Fatty acid biosynthesis
  • Steroid hormone biosynthesis
Reactions
Estradiol + NAD(P)(+) → Estrone + NAD(P)H details
Testosterone + NAD → Androstenedione + NADH details
Testosterone + NAD → Androstenedione + NADH + Hydrogen Ion details
Estradiol + NAD → Estrone + NADH + Hydrogen Ion details
Estradiol + NADP → Estrone + NADPH + Hydrogen Ion details
Estriol + NAD → 16b-Hydroxyestrone + NADH + Hydrogen Ion details
Estriol + NADP → 16b-Hydroxyestrone + NADPH + Hydrogen Ion details
11beta,17beta-Dihydroxy-4-androsten-3-one + NAD → 11b-Hydroxyandrost-4-ene-3,17-dione + NADH + Hydrogen Ion details
11beta,17beta-Dihydroxy-4-androsten-3-one + NADP → 11b-Hydroxyandrost-4-ene-3,17-dione + NADPH + Hydrogen Ion details
GO Classification
Biological Process
androgen metabolic process
fatty acid biosynthetic process
estrogen biosynthetic process
Cellular Component
mitochondrial matrix
plasma membrane
mitochondrial envelope
Function
binding
catalytic activity
oxidoreductase activity
Molecular Function
testosterone dehydrogenase (NAD+) activity
estradiol 17-beta-dehydrogenase activity
testosterone 17-beta-dehydrogenase (NAD+) activity
3-hydroxyacyl-CoA dehydrogenase activity
nucleotide binding
Process
metabolic process
oxidation reduction
Cellular Location
  1. Mitochondrion matrix
Gene Properties
Chromosome Location 6
Locus 6p21.3
SNPs HSD17B8
Gene Sequence
>786 bp
ATGGCGTCTCAGCTCCAGAACCGACTCCGCTCCGCACTGGCCTTGGTCACAGGTGCGGGG
AGCGGCATCGGCCGAGCGGTCAGTGTACGCCTGGCCGGAGAGGGGGCCACCGTAGCTGCC
TGCGACCTGGACCGGGCAGCGGCACAGGAGACGGTGCGGCTGCTGGGCGGGCCAGGGAGC
AAGGAGGGGCCGCCCCGAGGGAACCATGCTGCCTTCCAGGCTGACGTGTCTGAGGCCAGG
GCCGCCAGGTGCCTGCTGGAACAAGTGCAGGCCTGCTTTTCTCGCCCACCATCTGTCGTT
GTGTCCTGTGCGGGCATCACCCAGGATGAGTTTCTGCTGCACATGTCTGAGGATGACTGG
GACAAAGTCATAGCTGTCAACCTCAAGGGCACCTTCCTAGTCACTCAGGCTGCAGCACAA
GCCCTGGTGTCCAATGGTTGTCGTGGTTCCATCATCAACATCAGTAGCATCGTAGGAAAG
GTGGGGAACGTGGGGCAGACAAACTATGCAGCATCCAAGGCTGGAGTGATTGGGCTGACC
CAGACCGCAGCCCGGGAGCTTGGACGACATGGGATCCGCTGTAACTCTGTCCTCCCAGGG
TTCATTGCAACACCCATGACACAGAAAGTGCCACAGAAAGTGGTGGACAAGATTACTGAA
ATGATCCCGATGGGACACTTGGGGGACCCTGAGGATGTGGCAGATGTGGTCGCATTCTTG
GCATCTGAAGATAGTGGATACATCACAGGGACCTCAGTGGAAGTCACTGGAGGTCTTTTC
ATGTAG
Protein Properties
Number of Residues 261
Molecular Weight 26973.56
Theoretical pI 6.533
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Estradiol 17-beta-dehydrogenase 8
MASQLQNRLRSALALVTGAGSGIGRAVSVRLAGEGATVAACDLDRAAAQETVRLLGGPGS
KEGPPRGNHAAFQADVSEARAARCLLEQVQACFSRPPSVVVSCAGITQDEFLLHMSEDDW
DKVIAVNLKGTFLVTQAAAQALVSNGCRGSIINISSIVGKVGNVGQTNYAASKAGVIGLT
QTAARELGRHGIRCNSVLPGFIATPMTQKVPQKVVDKITEMIPMGHLGDPEDVADVVAFL
ASEDSGYITGTSVEVTGGLFM
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q92506
UniProtKB/Swiss-Prot Entry Name DHB8_HUMAN
PDB IDs
GenBank Gene ID BT007239
GeneCard ID HSD17B8
GenAtlas ID HSD17B8
HGNC ID HGNC:3554
References
General References
  1. Mungall AJ, Palmer SA, Sims SK, Edwards CA, Ashurst JL, Wilming L, Jones MC, Horton R, Hunt SE, Scott CE, Gilbert JG, Clamp ME, Bethel G, Milne S, Ainscough R, Almeida JP, Ambrose KD, Andrews TD, Ashwell RI, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beare DM, Beasley H, Beasley O, Bird CP, Blakey S, Bray-Allen S, Brook J, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Clark SY, Clark G, Clee CM, Clegg S, Cobley V, Collier RE, Collins JE, Colman LK, Corby NR, Coville GJ, Culley KM, Dhami P, Davies J, Dunn M, Earthrowl ME, Ellington AE, Evans KA, Faulkner L, Francis MD, Frankish A, Frankland J, French L, Garner P, Garnett J, Ghori MJ, Gilby LM, Gillson CJ, Glithero RJ, Grafham DV, Grant M, Gribble S, Griffiths C, Griffiths M, Hall R, Halls KS, Hammond S, Harley JL, Hart EA, Heath PD, Heathcott R, Holmes SJ, Howden PJ, Howe KL, Howell GR, Huckle E, Humphray SJ, Humphries MD, Hunt AR, Johnson CM, Joy AA, Kay M, Keenan SJ, Kimberley AM, King A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd CR, Lloyd DM, Loveland JE, Lovell J, Martin S, Mashreghi-Mohammadi M, Maslen GL, Matthews L, McCann OT, McLaren SJ, McLay K, McMurray A, Moore MJ, Mullikin JC, Niblett D, Nickerson T, Novik KL, Oliver K, Overton-Larty EK, Parker A, Patel R, Pearce AV, Peck AI, Phillimore B, Phillips S, Plumb RW, Porter KM, Ramsey Y, Ranby SA, Rice CM, Ross MT, Searle SM, Sehra HK, Sheridan E, Skuce CD, Smith S, Smith M, Spraggon L, Squares SL, Steward CA, Sycamore N, Tamlyn-Hall G, Tester J, Theaker AJ, Thomas DW, Thorpe A, Tracey A, Tromans A, Tubby B, Wall M, Wallis JM, West AP, White SS, Whitehead SL, Whittaker H, Wild A, Willey DJ, Wilmer TE, Wood JM, Wray PW, Wyatt JC, Young L, Younger RM, Bentley DR, Coulson A, Durbin R, Hubbard T, Sulston JE, Dunham I, Rogers J, Beck S: The DNA sequence and analysis of human chromosome 6. Nature. 2003 Oct 23;425(6960):805-11. [PubMed:14574404 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. [PubMed:16959974 ]
  4. Ando A, Kikuti YY, Shigenari A, Kawata H, Okamoto N, Shiina T, Chen L, Ikemura T, Abe K, Kimura M, Inoko H: cDNA cloning of the human homologues of the mouse Ke4 and Ke6 genes at the centromeric end of the human MHC region. Genomics. 1996 Aug 1;35(3):600-2. [PubMed:8812499 ]
  5. Ohno S, Nishikawa K, Honda Y, Nakajin S: Expression in E. coli and tissue distribution of the human homologue of the mouse Ke 6 gene, 17beta-hydroxysteroid dehydrogenase type 8. Mol Cell Biochem. 2008 Feb;309(1-2):209-15. Epub 2007 Nov 3. [PubMed:17978863 ]
  6. Chen Z, Kastaniotis AJ, Miinalainen IJ, Rajaram V, Wierenga RK, Hiltunen JK: 17beta-hydroxysteroid dehydrogenase type 8 and carbonyl reductase type 4 assemble as a ketoacyl reductase of human mitochondrial FAS. FASEB J. 2009 Nov;23(11):3682-91. doi: 10.1096/fj.09-133587. Epub 2009 Jul 1. [PubMed:19571038 ]
  7. Rotinen M, Celay J, Alonso MM, Arrazola A, Encio I, Villar J: Estradiol induces type 8 17beta-hydroxysteroid dehydrogenase expression: crosstalk between estrogen receptor alpha and C/EBPbeta. J Endocrinol. 2009 Jan;200(1):85-92. doi: 10.1677/JOE-08-0134. Epub 2008 Oct 13. [PubMed:18852215 ]