You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP00471
Secondary Accession Numbers
  • 5711
  • HMDBP05536
Name Tryptophan 5-hydroxylase 2
Synonyms
  1. Neuronal tryptophan hydroxylase
  2. Tryptophan 5-monooxygenase 2
Gene Name TPH2
Protein Type Enzyme
Biological Properties
General Function Involved in amino acid binding
Specific Function Not Available
Pathways
  • Serotonergic synapse
  • serotonin biosynthesis
  • Tryptophan metabolism
Reactions
L-Tryptophan + L-erythro-tetrahydrobiopterin + Oxygen → Oxitriptan + 4a-Hydroxytetrahydrobiopterin details
L-erythro-tetrahydrobiopterin + L-Tryptophan + Oxygen → Oxitriptan + 4a-Carbinolamine tetrahydrobiopterin + Water details
GO Classification
Biological Process
small molecule metabolic process
indolalkylamine biosynthetic process
cellular response to lithium ion
response to stress
serotonin biosynthetic process
response to calcium ion
aromatic amino acid family metabolic process
response to glucocorticoid stimulus
response to nutrient levels
response to activity
circadian rhythm
response to estrogen stimulus
Cellular Component
cytosol
neuron projection
Function
ion binding
cation binding
metal ion binding
binding
catalytic activity
transition metal ion binding
iron ion binding
monooxygenase activity
carboxylic acid binding
amino acid binding
oxidoreductase activity
tryptophan 5-monooxygenase activity
oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced pteridine as one donor, and incorporation of one atom of oxygen
Molecular Function
tryptophan 5-monooxygenase activity
iron ion binding
amino acid binding
Process
metabolic process
indolalkylamine metabolic process
cellular metabolic process
oxidation reduction
cellular amino acid derivative metabolic process
cellular biogenic amine metabolic process
cellular amino acid and derivative metabolic process
cellular amino acid metabolic process
serotonin metabolic process
serotonin biosynthetic process
aromatic amino acid family metabolic process
Cellular Location Not Available
Gene Properties
Chromosome Location 12
Locus 12q21.1
SNPs TPH2
Gene Sequence
>1473 bp
ATGCAGCCAGCAATGATGATGTTTTCCAGTAAATACTGGGCACGGAGAGGGTTTTCCCTG
GATTCAGCAGTGCCCGAAGAGCATCAGCTACTTGGCAGCTCAACACTAAATAAACCTAAC
TCTGGCAAAAATGACGACAAAGGCAACAAGGGAAGCAGCAAACGTGAAGCTGCTACCGAA
AGTGGCAAGACAGCAGTTGTTTTCTCCTTGAAGAATGAAGTTGGTGGATTGGTAAAAGCA
CTGAGGCTCTTTCAGGAAAAACGTGTCAACATGGTTCATATTGAATCCAGGAAATCTCGG
CGAAGAAGTTCTGAGGTTGAAATCTTTGTGGACTGTGAGTGTGGGAAAACAGAATTCAAT
GAGCTCATTCAGTTGCTGAAATTTCAAACCACTATTGTGACGCTGAATCCTCCAGAGAAC
ATTTGGACAGAGGAAGAAGAGCTAGAGGATGTGCCCTGGTTCCCTCGGAAGATCTCTGAG
TTAGACAAATGCTCTCACAGAGTTCTCATGTATGGTTCTGAGCTTGATGCTGACCACCCA
GGATTTAAGGACAATGTCTATCGACAGAGAAGAAAGTATTTTGTGGATGTGGCCATGGGT
TATAAATATGGTCAGCCCATTCCCAGGGTGGAGTATACTGAAGAAGAAACTAAAACTTGG
GGTGTTGTATTCCGGGAGCTCTCCAAACTCTATCCCACTCATGCTTGCCGAGAGTATTTG
AAAAACTTCCCTCTGCTGACTAAATACTGTGGCTACAGAGAGGACAATGTGCCTCAACTC
GAAGATGTCTCCATGTTTCTGAAAGAAAGGTCTGGCTTCACGGTGAGGCCGGTGGCTGGA
TACCTGAGCCCACGAGACTTTCTGGCAGGACTGGCCTACAGAGTGTTCCACTGTACCCAG
TACATCCGGCATGGCTCAGATCCCCTCTACACCCCAGAACCAGACACATGCCATGAACTC
TTGGGACATGTTCCACTACTTGCGGATCCTAAGTTTGCTCAGTTTTCACAAGAAATAGGT
CTGGCGTCTCTGGGAGCATCAGATGAAGATGTTCAGAAACTAGCCACGTGCTATTTCTTC
ACAATCGAGTTTGGCCTTTGCAAGCAAGAAGGGCAACTGCGGGCATATGGAGCAGGACTC
CTTTCCTCCATTGGAGAATTAAAGCACGCCCTTTCTGACAAGGCATGTGTGAAAGCCTTT
GACCCAAAGACAACTTGCTTACAGGAATGCCTTATCACCACCTTCCAGGAAGCCTACTTT
GTTTCAGAAAGTTTTGAAGAAGCCAAAGAAAAGATGAGGGACTTTGCAAAGTCAATTACC
CGTCCCTTCTCAGTATACTTCAATCCCTACACACAGAGTATTGAAATTCTGAAAGACACC
AGAAGTATTGAAAATGTGGTGCAGGACCTTCGCAGCGACTTGAATACAGTGTGTGATGCT
TTAAACAAAATGAACCAATATCTGGGGATTTGA
Protein Properties
Number of Residues 490
Molecular Weight 56056.295
Theoretical pI 6.415
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Tryptophan 5-hydroxylase 2
MQPAMMMFSSKYWARRGFSLDSAVPEEHQLLGSSTLNKPNSGKNDDKGNKGSSKREAATE
SGKTAVVFSLKNEVGGLVKALRLFQEKRVNMVHIESRKSRRRSSEVEIFVDCECGKTEFN
ELIQLLKFQTTIVTLNPPENIWTEEEELEDVPWFPRKISELDKCSHRVLMYGSELDADHP
GFKDNVYRQRRKYFVDVAMGYKYGQPIPRVEYTEEETKTWGVVFRELSKLYPTHACREYL
KNFPLLTKYCGYREDNVPQLEDVSMFLKERSGFTVRPVAGYLSPRDFLAGLAYRVFHCTQ
YIRHGSDPLYTPEPDTCHELLGHVPLLADPKFAQFSQEIGLASLGASDEDVQKLATCYFF
TIEFGLCKQEGQLRAYGAGLLSSIGELKHALSDKACVKAFDPKTTCLQECLITTFQEAYF
VSESFEEAKEKMRDFAKSITRPFSVYFNPYTQSIEILKDTRSIENVVQDLRSDLNTVCDA
LNKMNQYLGI
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q8IWU9
UniProtKB/Swiss-Prot Entry Name TPH2_HUMAN
PDB IDs Not Available
GenBank Gene ID AY098914
GeneCard ID TPH2
GenAtlas ID TPH2
HGNC ID HGNC:20692
References
General References
  1. Scherer SE, Muzny DM, Buhay CJ, Chen R, Cree A, Ding Y, Dugan-Rocha S, Gill R, Gunaratne P, Harris RA, Hawes AC, Hernandez J, Hodgson AV, Hume J, Jackson A, Khan ZM, Kovar-Smith C, Lewis LR, Lozado RJ, Metzker ML, Milosavljevic A, Miner GR, Montgomery KT, Morgan MB, Nazareth LV, Scott G, Sodergren E, Song XZ, Steffen D, Lovering RC, Wheeler DA, Worley KC, Yuan Y, Zhang Z, Adams CQ, Ansari-Lari MA, Ayele M, Brown MJ, Chen G, Chen Z, Clerc-Blankenburg KP, Davis C, Delgado O, Dinh HH, Draper H, Gonzalez-Garay ML, Havlak P, Jackson LR, Jacob LS, Kelly SH, Li L, Li Z, Liu J, Liu W, Lu J, Maheshwari M, Nguyen BV, Okwuonu GO, Pasternak S, Perez LM, Plopper FJ, Santibanez J, Shen H, Tabor PE, Verduzco D, Waldron L, Wang Q, Williams GA, Zhang J, Zhou J, Allen CC, Amin AG, Anyalebechi V, Bailey M, Barbaria JA, Bimage KE, Bryant NP, Burch PE, Burkett CE, Burrell KL, Calderon E, Cardenas V, Carter K, Casias K, Cavazos I, Cavazos SR, Ceasar H, Chacko J, Chan SN, Chavez D, Christopoulos C, Chu J, Cockrell R, Cox CD, Dang M, Dathorne SR, David R, Davis CM, Davy-Carroll L, Deshazo DR, Donlin JE, D'Souza L, Eaves KA, Egan A, Emery-Cohen AJ, Escotto M, Flagg N, Forbes LD, Gabisi AM, Garza M, Hamilton C, Henderson N, Hernandez O, Hines S, Hogues ME, Huang M, Idlebird DG, Johnson R, Jolivet A, Jones S, Kagan R, King LM, Leal B, Lebow H, Lee S, LeVan JM, Lewis LC, London P, Lorensuhewa LM, Loulseged H, Lovett DA, Lucier A, Lucier RL, Ma J, Madu RC, Mapua P, Martindale AD, Martinez E, Massey E, Mawhiney S, Meador MG, Mendez S, Mercado C, Mercado IC, Merritt CE, Miner ZL, Minja E, Mitchell T, Mohabbat F, Mohabbat K, Montgomery B, Moore N, Morris S, Munidasa M, Ngo RN, Nguyen NB, Nickerson E, Nwaokelemeh OO, Nwokenkwo S, Obregon M, Oguh M, Oragunye N, Oviedo RJ, Parish BJ, Parker DN, Parrish J, Parks KL, Paul HA, Payton BA, Perez A, Perrin W, Pickens A, Primus EL, Pu LL, Puazo M, Quiles MM, Quiroz JB, Rabata D, Reeves K, Ruiz SJ, Shao H, Sisson I, Sonaike T, Sorelle RP, Sutton AE, Svatek AF, Svetz LA, Tamerisa KS, Taylor TR, Teague B, Thomas N, Thorn RD, Trejos ZY, Trevino BK, Ukegbu ON, Urban JB, Vasquez LI, Vera VA, Villasana DM, Wang L, Ward-Moore S, Warren JT, Wei X, White F, Williamson AL, Wleczyk R, Wooden HS, Wooden SH, Yen J, Yoon L, Yoon V, Zorrilla SE, Nelson D, Kucherlapati R, Weinstock G, Gibbs RA: The finished DNA sequence of human chromosome 12. Nature. 2006 Mar 16;440(7082):346-51. [PubMed:16541075 ]
  2. Molina H, Horn DM, Tang N, Mathivanan S, Pandey A: Global proteomic profiling of phosphopeptides using electron transfer dissociation tandem mass spectrometry. Proc Natl Acad Sci U S A. 2007 Feb 13;104(7):2199-204. Epub 2007 Feb 7. [PubMed:17287340 ]
  3. Walther DJ, Peter JU, Bashammakh S, Hortnagl H, Voits M, Fink H, Bader M: Synthesis of serotonin by a second tryptophan hydroxylase isoform. Science. 2003 Jan 3;299(5603):76. [PubMed:12511643 ]
  4. Cichon S, Winge I, Mattheisen M, Georgi A, Karpushova A, Freudenberg J, Freudenberg-Hua Y, Babadjanova G, Van Den Bogaert A, Abramova LI, Kapiletti S, Knappskog PM, McKinney J, Maier W, Jamra RA, Schulze TG, Schumacher J, Propping P, Rietschel M, Haavik J, Nothen MM: Brain-specific tryptophan hydroxylase 2 (TPH2): a functional Pro206Ser substitution and variation in the 5'-region are associated with bipolar affective disorder. Hum Mol Genet. 2008 Jan 1;17(1):87-97. Epub 2007 Sep 27. [PubMed:17905754 ]
  5. Zhang X, Gainetdinov RR, Beaulieu JM, Sotnikova TD, Burch LH, Williams RB, Schwartz DA, Krishnan KR, Caron MG: Loss-of-function mutation in tryptophan hydroxylase-2 identified in unipolar major depression. Neuron. 2005 Jan 6;45(1):11-6. [PubMed:15629698 ]
  6. McKinney J, Johansson S, Halmoy A, Dramsdahl M, Winge I, Knappskog PM, Haavik J: A loss-of-function mutation in tryptophan hydroxylase 2 segregating with attention-deficit/hyperactivity disorder. Mol Psychiatry. 2008 Apr;13(4):365-7. doi: 10.1038/sj.mp.4002152. [PubMed:18347598 ]
  7. McKinney JA, Turel B, Winge I, Knappskog PM, Haavik J: Functional properties of missense variants of human tryptophan hydroxylase 2. Hum Mutat. 2009 May;30(5):787-94. doi: 10.1002/humu.20956. [PubMed:19319927 ]