You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP00498
Secondary Accession Numbers
  • 5745
Name Cocaine esterase
Synonyms
  1. CE-2
  2. hCE-2
  3. Carboxylesterase 2
  4. Methylumbelliferyl-acetate deacetylase 2
Gene Name CES2
Protein Type Enzyme
Biological Properties
General Function Lipid transport and metabolism
Specific Function Involved in the detoxification of xenobiotics and in the activation of ester and amide prodrugs. Shows high catalytic efficiency for hydrolysis of cocaine, 4-methylumbelliferyl acetate, heroin and 6-monoacetylmorphine.
Pathways
  • Drug metabolism - other enzymes
  • Heroin Action Pathway
  • Heroin Metabolism Pathway
  • Irinotecan Action Pathway
  • Irinotecan Metabolism Pathway
  • Mycophenolic Acid Metabolism Pathway
Reactions
Cocaine + Water → Ecgonine methyl ester + Benzoic acid details
A carboxylic ester + Water → an alcohol + a carboxylate details
4-Methylumbelliferyl acetate + Water → 4-Methylumbelliferone + Acetic acid details
Capecitabine + Water → 5'-Deoxy-5-fluorocytidine + 1-Pentanol + Carbon dioxide details
Irinotecan + Water → SN-38 + 1,4'-Bipiperidine-1'-carboxylic acid details
NPC + Water → SN-38 + 4-Amino-1-piperidinecarboxylic acid details
GO Classification
Biological Process
catabolic process
Cellular Component
endoplasmic reticulum
endoplasmic reticulum lumen
Molecular Function
carboxylesterase activity
retinyl-palmitate esterase activity
methyl indole-3-acetate esterase activity
methyl jasmonate esterase activity
methyl salicylate esterase activity
methylumbelliferyl-acetate deacetylase activity
Cellular Location
  1. Endoplasmic reticulum lumen
Gene Properties
Chromosome Location 16
Locus 16q22.1
SNPs CES2
Gene Sequence
>1680 bp
ATGCGGCTGCACAGACTTCGTGCGCGGCTGAGCGCGGTGGCCTGTGGGCTTCTGCTGCTT
CTTGTCCGGGGCCAGGGCCAGGACTCAGCCAGTCCCATCCGGACCACACACACGGGGCAG
GTGCTGGGGAGTCTTGTCCATGTGAAGGGCGCCAATGCCGGGGTCCAAACCTTCCTGGGA
ATTCCATTTGCCAAGCCACCTCTAGGTCCGCTGCGATTTGCACCCCCTGAGCCCCCTGAA
TCTTGGAGTGGTGTGAGGGATGGAACCACCCATCCGGCCATGTGTCTACAGGACCTCACC
GCAGTGGAGTCAGAGTTTCTTAGCCAGTTCAACATGACCTTCCCTTCCGACTCCATGTCT
GAGGACTGCCTGTACCTCAGCATCTACACGCCGGCCCATAGCCATGAAGGCTCTAACCTG
CCGGTGATGGTGTGGATCCACGGTGGTGCGCTTGTTTTTGGCATGGCTTCCTTGTATGAT
GGTTCCATGCTGGCTGCCTTGGAGAACGTGGTGGTGGTCATCATCCAGTACCGCCTGGGT
GTCCTGGGCTTCTTCAGCACTGGAGACAAGCACGCAACCGGCAACTGGGGCTACCTGGAC
CAAGTGGCTGCACTACGCTGGGTCCAGCAGAATATCGCCCACTTTGGAGGCAACCCTGAC
CGTGTCACCATTTTTGGCGAGTCTGCGGGTGGCACGAGTGTGTCTTCGCTTGTTGTGTCC
CCCATATCCCAAGGACTCTTCCACGGAGCCATCATGGAGAGTGGCGTGGCCCTCCTGCCC
GGCCTCATTGCCAGCTCAGCTGATGTCATCTCCACGGTGGTGGCCAACCTGTCTGCCTGT
GACCAAGTTGACTCTGAGGCCCTGGTGGGCTGCCTGCGGGGCAAGAGTAAAGAGGAGATT
CTTGCAATTAACAAGCCTTTCAAGATGATCCCCGGAGTGGTGGATGGGGTCTTCCTGCCC
AGGCACCCCCAGGAGCTGCTGGCCTCTGCCGACTTTCAGCCTGTCCCTAGCATTGTTGGT
GTCAACAACAATGAATTCGGCTGGCTCATCCCCAAGGTCATGAGGATCTATGATACCCAG
AAGGAAATGGACAGAGAGGCCTCCCAGGCTGCTCTGCAGAAAATGTTAACGCTGCTGATG
TTGCCTCCTACATTTGGTGACCTGCTGAGGGAGGAGTACATTGGGGACAATGGGGATCCC
CAGACCCTCCAAGCGCAGTTCCAGGAGATGATGGCGGACTCCATGTTTGTGATCCCTGCA
CTCCAAGTAGCACATTTTCAGTGTTCCCGGGCCCCTGTGTACTTCTACGAGTTCCAGCAT
CAGCCCAGCTGGCTCAAGAACATCAGGCCACCGCACATGAAGGCAGACCATGGTGATGAG
CTTCCTTTTGTTTTCAGAAGTTTCTTTGGGGGCAACTACATTAAATTCACTGAGGAAGAG
GAGCAGCTAAGCAGGAAGATGATGAAGTACTGGGCCAACTTTGCGAGAAATGGGAACCCC
AATGGCGAGGGTCTGCCACACTGGCCGCTGTTCGACCAGGAGGAGCAATACCTGCAGCTG
AACCTACAGCCTGCGGTGGGCCGGGCTCTGAAGGCCCACAGGCTCCAGTTCTGGAAGAAG
GCGCTGCCCCAAAAGATCCAGGAGCTCGAGGAGCCTGAAGAGAGACACACAGAGCTGTAG
Protein Properties
Number of Residues 559
Molecular Weight 68898.39
Theoretical pI 6.489
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Carboxylesterase 2
MRLHRLRARLSAVACGLLLLLVRGQGQDSASPIRTTHTGQVLGSLVHVKGANAGVQTFLG
IPFAKPPLGPLRFAPPEPPESWSGVRDGTTHPAMCLQDLTAVESEFLSQFNMTFPSDSMS
EDCLYLSIYTPAHSHEGSNLPVMVWIHGGALVFGMASLYDGSMLAALENVVVVIIQYRLG
VLGFFSTGDKHATGNWGYLDQVAALRWVQQNIAHFGGNPDRVTIFGESAGGTSVSSLVVS
PISQGLFHGAIMESGVALLPGLIASSADVISTVVANLSACDQVDSEALVGCLRGKSKEEI
LAINKPFKMIPGVVDGVFLPRHPQELLASADFQPVPSIVGVNNNEFGWLIPKVMRIYDTQ
KEMDREASQAALQKMLTLLMLPPTFGDLLREEYIGDNGDPQTLQAQFQEMMADSMFVIPA
LQVAHFQCSRAPVYFYEFQHQPSWLKNIRPPHMKADHGDELPFVFRSFFGGNYIKFTEEE
EQLSRKMMKYWANFARNGNPNGEGLPHWPLFDQEEQYLQLNLQPAVGRALKAHRLQFWKK
ALPQKIQELEEPEERHTEL
GenBank ID Protein 2058318
UniProtKB/Swiss-Prot ID O00748
UniProtKB/Swiss-Prot Entry Name EST2_HUMAN
PDB IDs Not Available
GenBank Gene ID Y09616
GeneCard ID CES2
GenAtlas ID CES2
HGNC ID HGNC:1864
References
General References
  1. Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res. 2009 Feb;8(2):651-61. doi: 10.1021/pr8008012. [PubMed:19159218 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  4. Martin J, Han C, Gordon LA, Terry A, Prabhakar S, She X, Xie G, Hellsten U, Chan YM, Altherr M, Couronne O, Aerts A, Bajorek E, Black S, Blumer H, Branscomb E, Brown NC, Bruno WJ, Buckingham JM, Callen DF, Campbell CS, Campbell ML, Campbell EW, Caoile C, Challacombe JF, Chasteen LA, Chertkov O, Chi HC, Christensen M, Clark LM, Cohn JD, Denys M, Detter JC, Dickson M, Dimitrijevic-Bussod M, Escobar J, Fawcett JJ, Flowers D, Fotopulos D, Glavina T, Gomez M, Gonzales E, Goodstein D, Goodwin LA, Grady DL, Grigoriev I, Groza M, Hammon N, Hawkins T, Haydu L, Hildebrand CE, Huang W, Israni S, Jett J, Jewett PB, Kadner K, Kimball H, Kobayashi A, Krawczyk MC, Leyba T, Longmire JL, Lopez F, Lou Y, Lowry S, Ludeman T, Manohar CF, Mark GA, McMurray KL, Meincke LJ, Morgan J, Moyzis RK, Mundt MO, Munk AC, Nandkeshwar RD, Pitluck S, Pollard M, Predki P, Parson-Quintana B, Ramirez L, Rash S, Retterer J, Ricke DO, Robinson DL, Rodriguez A, Salamov A, Saunders EH, Scott D, Shough T, Stallings RL, Stalvey M, Sutherland RD, Tapia R, Tesmer JG, Thayer N, Thompson LS, Tice H, Torney DC, Tran-Gyamfi M, Tsai M, Ulanovsky LE, Ustaszewska A, Vo N, White PS, Williams AL, Wills PL, Wu JR, Wu K, Yang J, Dejong P, Bruce D, Doggett NA, Deaven L, Schmutz J, Grimwood J, Richardson P, Rokhsar DS, Eichler EE, Gilna P, Lucas SM, Myers RM, Rubin EM, Pennacchio LA: The sequence and analysis of duplication-rich human chromosome 16. Nature. 2004 Dec 23;432(7020):988-94. [PubMed:15616553 ]
  5. Schwer H, Langmann T, Daig R, Becker A, Aslanidis C, Schmitz G: Molecular cloning and characterization of a novel putative carboxylesterase, present in human intestine and liver. Biochem Biophys Res Commun. 1997 Apr 7;233(1):117-20. [PubMed:9144407 ]
  6. Pindel EV, Kedishvili NY, Abraham TL, Brzezinski MR, Zhang J, Dean RA, Bosron WF: Purification and cloning of a broad substrate specificity human liver carboxylesterase that catalyzes the hydrolysis of cocaine and heroin. J Biol Chem. 1997 Jun 6;272(23):14769-75. [PubMed:9169443 ]
  7. Saito S, Iida A, Sekine A, Kawauchi S, Higuchi S, Ogawa C, Nakamura Y: Catalog of 680 variations among eight cytochrome p450 ( CYP) genes, nine esterase genes, and two other genes in the Japanese population. J Hum Genet. 2003;48(5):249-70. Epub 2003 Apr 29. [PubMed:12721789 ]
  8. Kim SR, Nakamura T, Saito Y, Sai K, Nakajima T, Saito H, Shirao K, Minami H, Ohtsu A, Yoshida T, Saijo N, Ozawa S, Sawada J: Twelve novel single nucleotide polymorphisms in the CES2 gene encoding human carboxylesterase 2 (hCE-2). Drug Metab Pharmacokinet. 2003;18(5):327-32. [PubMed:15618752 ]