Canmetcon
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP00581
Secondary Accession Numbers
  • 5853
Name Threonine--tRNA ligase, cytoplasmic
Synonyms
  1. ThrRS
  2. Threonine--tRNA ligase
  3. Threonyl-tRNA synthetase
Gene Name TARS
Protein Type Enzyme
Biological Properties
General Function Involved in nucleotide binding
Specific Function Not Available
Pathways
  • Aminoacyl-tRNA biosynthesis
  • Glycine and Serine Metabolism
Reactions
Adenosine triphosphate + L-Threonine + tRNA(Thr) → Adenosine monophosphate + Pyrophosphate + L-threonyl-tRNA(Thr) details
Adenosine triphosphate + L-Threonine + tRNA(Thr) → Adenosine monophosphate + Pyrophosphate + L-Threonyl-tRNA(Thr) details
GO Classification
Biological Process
threonyl-tRNA aminoacylation
Cellular Component
cytosol
actin cytoskeleton
cytoplasm
Component
cell part
intracellular part
cytoplasm
Function
binding
nucleotide binding
catalytic activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
ligase activity
threonine-trna ligase activity
ligase activity, forming carbon-oxygen bonds
ligase activity, forming aminoacyl-trna and related compounds
aminoacyl-trna ligase activity
Molecular Function
ATP binding
protein homodimerization activity
threonine-tRNA ligase activity
Process
rna metabolic process
ncrna metabolic process
trna metabolic process
trna aminoacylation
trna aminoacylation for protein translation
macromolecule biosynthetic process
cellular macromolecule biosynthetic process
translation
metabolic process
macromolecule metabolic process
cellular macromolecule metabolic process
threonyl-trna aminoacylation
biosynthetic process
Cellular Location
  1. Cytoplasm
Gene Properties
Chromosome Location 5
Locus 5p13.2
SNPs TARS
Gene Sequence
>2172 bp
ATGTTTGAGGAGAAGGCCAGCAGTCCTTCAGGGAAGATGGGAGGCGAGGAGAAGCCGATT
GGTGCTGGTGAAGAGAAGCAAAAGGAAGGAGGCAAAAAGAAGAACAAAGAAGGATCTGGA
GATGGAGGTCGAGCTGAGTTGAATCCTTGGCCTGAATATATTTACACACGTCTTGAGATG
TATAATATACTAAAAGCAGAACATGATTCCATTCTGGCAGAAAAGGCAGAAAAAGATAGC
AAGCCAATTAAAGTCACTTTGCCTGATGGTAAACAGGTTGATGCGGAATCTTGGAAAACT
ACACCATATCAAATTGCCTGTGGAATTAGTCAAGGCCTGGCCGACAACACCGTTATTGCT
AAAGTAAATAATGTTGTGTGGGACCTGGACCGCCCTCTGGAAGAAGATTGTACCTTGGAG
CTTCTCAAGTTTGAGGATGAGGAAGCTCAGGCAGTGTATTGGCACTCTAGTGCTCACATA
ATGGGTGAAGCCATGGAAAGAGTCTATGGTGGATGTTTATGCTACGGTCCGCCAATAGAA
AATGGATTCTATTATGACATGTACCTCGAAGAAGGGGGTGTGTCTAGCAATGATTTCTCT
TCTCTGGAGGCTTTGTGTAAGAAAATCATTAAAGAAAAACAAGCTTTTGAAAGACTGGAA
GTTAAGAAAGAAACTTTACTGGCAATGTTTAAGTACAACAAGTTCAAATGCCGGATATTG
AATGAAAAGGTGAATACTCCAACTACCACAGTCTATAGATGTGGCCCTTTGATAGATCTC
TGCCGGGGTCCTCATGTTAGACACACGGGCAAAATTAAGGCTTTAAAAATACACAAAAAT
TCCTCCACGTACTGGGAAGGCAAAGCAGATATGGAGACTCTCCAGAGAATTTATGGCATT
TCATTCCCAGATCCTAAAATGTTGAAAGAGTGGGAGAAGTTCCAAGAGGAAGCTAAAAAC
CGAGATCATAGGAAAATTGGCAGGGACCAAGAACTATATTTCTTTCATGAACTCAGCCCT
GGAAGTTGCTTTTTTCTGCCAAAAGGAGCCTACATTTATAATGCACTTATTGAATTCATT
AGGAGCGAATATAGGAAAAGAGGATTCCAGGAGGTAGTCACCCCAAACATCTTCAACAGC
CGACTCTGGATGACCTCGGGCCACTGGCAGCACTACAGCGAGAACATGTTCTCCTTTGAG
GTGGAGAAGGAGCTGTTTGCCCTGAAACCCATGAACTGCCCAGGACACTGCCTTATGTTT
GATCATCGGCCAAGGTCCTGGCGAGAACTGCCTCTGCGGCTAGCTGATTTTGGGGTACTT
CATAGGAACGAGCTGTCTGGAGCACTCACAGGACTCACCCGGGTACGAAGATTCCAACAG
GATGATGCTCACATATTCTGTGCCATGGAGCAGATTGAAGATGAAATAAAAGGTTGTTTG
GATTTTCTACGTACGGTATATAGCGTATTTGGATTTTCTTTTAAACTAAACCTTTCTACT
CGCCCGGAAAAATTCCTTGGAGATATCGAAGTATGGGATCAAGCTGAGAAACAACTTGAA
AACAGTCTGAATGAATTTGGTGAAAAGTGGGAGTTAAACTCTGGAGATGGAGCTTTCTAT
GGCCCAAAGATTGACATACAGATTAAAGATGCGATTGGGCGGTACCACCAGTGTGCAACC
ATCCAGCTGGATTTCCAGTTGCCCATCAGATTTAATCTTACTTATGTAAGCCATGATGGT
GATGATAAGAAAAGGCCAGTGATTGTTCATCGAGCCATCTTGGGATCAGTGGAAAGAATG
ATTGCTATCCTCACAGAAAACTATGGGGGCAAATGGCCCTTTTGGCTGTCCCCTCGCCAG
GTAATGGTAGTTCCAGTGGGACCAACCTGTGATGAATATGCCCAAAAGGTACGACAACAA
TTCCACGATGCCAAATTCATGGCAGACATTGATCTGGATCCAGGCTGTACATTGAATAAA
AAGATTCGAAATGCACAGTTAGCACAGTATAACTTCATTTTAGTTGTTGGTGAAAAAGAG
AAAATCAGTGGCACTGTTAATATCCGCACAAGAGACAATAAGGTCCACGGGGAACGCACC
ATTTCTGAAACTATCGAGCGGCTACAGCAGCTCAAAGAGTTCCGCAGCAAACAGGCAGAA
GAAGAATTTTAA
Protein Properties
Number of Residues 723
Molecular Weight 83434.5
Theoretical pI 6.664
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Threonyl-tRNA synthetase, cytoplasmic
MFEEKASSPSGKMGGEEKPIGAGEEKQKEGGKKKNKEGSGDGGRAELNPWPEYIYTRLEM
YNILKAEHDSILAEKAEKDSKPIKVTLPDGKQVDAESWKTTPYQIACGISQGLADNTVIA
KVNNVVWDLDRPLEEDCTLELLKFEDEEAQAVYWHSSAHIMGEAMERVYGGCLCYGPPIE
NGFYYDMYLEEGGVSSNDFSSLEALCKKIIKEKQAFERLEVKKETLLAMFKYNKFKCRIL
NEKVNTPTTTVYRCGPLIDLCRGPHVRHTGKIKALKIHKNSSTYWEGKADMETLQRIYGI
SFPDPKMLKEWEKFQEEAKNRDHRKIGRDQELYFFHELSPGSCFFLPKGAYIYNALIEFI
RSEYRKRGFQEVVTPNIFNSRLWMTSGHWQHYSENMFSFEVEKELFALKPMNCPGHCLMF
DHRPRSWRELPLRLADFGVLHRNELSGALTGLTRVRRFQQDDAHIFCAMEQIEDEIKGCL
DFLRTVYSVFGFSFKLNLSTRPEKFLGDIEVWDQAEKQLENSLNEFGEKWELNSGDGAFY
GPKIDIQIKDAIGRYHQCATIQLDFQLPIRFNLTYVSHDGDDKKRPVIVHRAILGSVERM
IAILTENYGGKWPFWLSPRQVMVVPVGPTCDEYAQKVRQQFHDAKFMADIDLDPGCTLNK
KIRNAQLAQYNFILVVGEKEKISGTVNIRTRDNKVHGERTISETIERLQQLKEFRSKQAE
EEF
GenBank ID Protein 158258124
UniProtKB/Swiss-Prot ID P26639
UniProtKB/Swiss-Prot Entry Name SYTC_HUMAN
PDB IDs
GenBank Gene ID AK292346
GeneCard ID TARS
GenAtlas ID TARS
HGNC ID HGNC:11572
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. [PubMed:19608861 ]
  4. Rikova K, Guo A, Zeng Q, Possemato A, Yu J, Haack H, Nardone J, Lee K, Reeves C, Li Y, Hu Y, Tan Z, Stokes M, Sullivan L, Mitchell J, Wetzel R, Macneill J, Ren JM, Yuan J, Bakalarski CE, Villen J, Kornhauser JM, Smith B, Li D, Zhou X, Gygi SP, Gu TL, Polakiewicz RD, Rush J, Comb MJ: Global survey of phosphotyrosine signaling identifies oncogenic kinases in lung cancer. Cell. 2007 Dec 14;131(6):1190-203. [PubMed:18083107 ]
  5. Cruzen ME, Arfin SM: Nucleotide and deduced amino acid sequence of human threonyl-tRNA synthetase reveals extensive homology to the Escherichia coli and yeast enzymes. J Biol Chem. 1991 May 25;266(15):9919-23. [PubMed:2033077 ]
  6. Vasilescu J, Zweitzig DR, Denis NJ, Smith JC, Ethier M, Haines DS, Figeys D: The proteomic reactor facilitates the analysis of affinity-purified proteins by mass spectrometry: application for identifying ubiquitinated proteins in human cells. J Proteome Res. 2007 Jan;6(1):298-305. [PubMed:17203973 ]