You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP00590
Secondary Accession Numbers
  • 5862
  • HMDBP04382
Name High affinity cAMP-specific 3',5'-cyclic phosphodiesterase 7A
Synonyms
  1. HCP1
  2. TM22
Gene Name PDE7A
Protein Type Unknown
Biological Properties
General Function Involved in 3',5'-cyclic-AMP phosphodiesterase activity
Specific Function Hydrolyzes the second messenger cAMP, which is a key regulator of many important physiological processes. May have a role in muscle signal transduction.
Pathways
  • 3',5'-cyclic AMP degradation
  • Morphine addiction
  • Purine metabolism
Reactions
Adenosine 3',5'-cyclic phosphate + Water → Adenosine monophosphate details
Cyclic AMP + Water → Adenosine monophosphate details
Cyclic GMP + Water → Guanosine monophosphate details
GO Classification
Biological Process
signal transduction
cAMP-mediated signaling
cAMP catabolic process
Cellular Component
cytosol
Function
hydrolase activity, acting on ester bonds
catalytic activity
hydrolase activity
cyclic-nucleotide phosphodiesterase activity
3',5'-cyclic-nucleotide phosphodiesterase activity
phosphoric ester hydrolase activity
phosphoric diester hydrolase activity
Molecular Function
metal ion binding
3',5'-cyclic-AMP phosphodiesterase activity
Process
biological regulation
regulation of biological process
regulation of cellular process
signal transduction
Cellular Location
  1. Isoform PDE7A2:Cytoplasm
Gene Properties
Chromosome Location 8
Locus 8q13
SNPs PDE7A
Gene Sequence
>1449 bp
ATGGAAGTGTGTTACCAGCTGCCGGTACTGCCCCTGGACAGGCCGGTCCCCCAGCACGTC
CTCAGCCGCCGAGGAGCCATCAGCTTCAGCTCCAGCTCCGCTCTCTTCGGCTGCCCCAAT
CCCCGGCAGCTCTCTCAGAGGCGTGGAGCTATTTCCTATGACAGTTCTGATCAGACTGCA
TTATACATTCGTATGCTAGGAGATGTACGTGTAAGGAGCCGAGCAGGATTTGAATCAGAA
AGAAGAGGTTCTCACCCATATATTGATTTTCGTATTTTCCACTCTCAATCTGAAATTGAA
GTGTCTGTCTCTGCAAGGAATATCAGAAGGCTACTAAGTTTCCAGCGATATCTTAGATCT
TCACGCTTTTTTCGTGGTACTGCGGTTTCAAATTCCCTAAACATTTTAGATGATGATTAT
AATGGACAAGCCAAGTGTATGCTGGAAAAAGTTGGAAATTGGAATTTTGATATCTTTCTA
TTTGATAGACTAACAAATGGAAATAGTCTAGTAAGCTTAACCTTTCATTTATTTAGTCTT
CATGGATTAATTGAGTACTTCCATTTAGATATGATGAAACTTCGTAGATTTTTAGTTATG
ATTCAAGAAGATTACCACAGTCAAAATCCTTACCATAACGCAGTCCACGCTGCGGATGTT
ACTCAGGCCATGCACTGTTACTTAAAGGAACCTAAGCTTGCCAATTCTGTAACTCCTTGG
GATATCTTGCTGAGCTTAATTGCAGCTGCCACTCATGATCTGGATCATCCAGGTGTTAAT
CAACCTTTCCTTATTAAAACTAACCATTACTTGGCAACTTTATACAAGAATACCTCAGTA
CTGGAAAATCACCACTGGAGATCTGCAGTGGGCTTATTGAGAGAATCAGGCTTATTCTCA
CATCTGCCATTAGAAAGCAGGCAACAAATGGAGACACAGATAGGTGCTCTGATACTAGCC
ACAGACATCAGTCGCCAGAATGAGTATCTGTCTTTGTTTAGGTCCCATTTGGATAGAGGT
GATTTATGCCTAGAAGACACCAGACACAGACATTTGGTTTTACAGATGGCTTTGAAATGT
GCTGATATTTGTAACCCATGTCGGACGTGGGAATTAAGCAAGCAGTGGAGTGAAAAAGTA
ACGGAGGAATTCTTCCATCAAGGAGATATAGAAAAAAAATATCATTTGGGTGTGAGTCCA
CTTTGCGATCGTCACACTGAATCTATTGCCAACATCCAGATTGGTTTTATGACTTACCTA
GTGGAGCCTTTATTTACAGAATGGGCCAGGTTTTCCAATACAAGGCTATCCCAGACAATG
CTTGGACACGTGGGGCTGAATAAAGCCAGCTGGAAGGGACTGCAGAGAGAACAGTCGAGC
AGTGAGGACACTGATGCTGCATTTGAGTTGAACTCACAGTTATTACCTCAGGAAAATCGG
TTATCATAA
Protein Properties
Number of Residues 482
Molecular Weight 55504.475
Theoretical pI 7.497
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>High affinity cAMP-specific 3',5'-cyclic phosphodiesterase 7A
MEVCYQLPVLPLDRPVPQHVLSRRGAISFSSSSALFGCPNPRQLSQRRGAISYDSSDQTA
LYIRMLGDVRVRSRAGFESERRGSHPYIDFRIFHSQSEIEVSVSARNIRRLLSFQRYLRS
SRFFRGTAVSNSLNILDDDYNGQAKCMLEKVGNWNFDIFLFDRLTNGNSLVSLTFHLFSL
HGLIEYFHLDMMKLRRFLVMIQEDYHSQNPYHNAVHAADVTQAMHCYLKEPKLANSVTPW
DILLSLIAAATHDLDHPGVNQPFLIKTNHYLATLYKNTSVLENHHWRSAVGLLRESGLFS
HLPLESRQQMETQIGALILATDISRQNEYLSLFRSHLDRGDLCLEDTRHRHLVLQMALKC
ADICNPCRTWELSKQWSEKVTEEFFHQGDIEKKYHLGVSPLCDRHTESIANIQIGFMTYL
VEPLFTEWARFSNTRLSQTMLGHVGLNKASWKGLQREQSSSEDTDAAFELNSQLLPQENR
LS
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q13946
UniProtKB/Swiss-Prot Entry Name PDE7A_HUMAN
PDB IDs
GenBank Gene ID L12052
GeneCard ID PDE7A
GenAtlas ID Not Available
HGNC ID HGNC:8791
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Nusbaum C, Mikkelsen TS, Zody MC, Asakawa S, Taudien S, Garber M, Kodira CD, Schueler MG, Shimizu A, Whittaker CA, Chang JL, Cuomo CA, Dewar K, FitzGerald MG, Yang X, Allen NR, Anderson S, Asakawa T, Blechschmidt K, Bloom T, Borowsky ML, Butler J, Cook A, Corum B, DeArellano K, DeCaprio D, Dooley KT, Dorris L 3rd, Engels R, Glockner G, Hafez N, Hagopian DS, Hall JL, Ishikawa SK, Jaffe DB, Kamat A, Kudoh J, Lehmann R, Lokitsang T, Macdonald P, Major JE, Matthews CD, Mauceli E, Menzel U, Mihalev AH, Minoshima S, Murayama Y, Naylor JW, Nicol R, Nguyen C, O'Leary SB, O'Neill K, Parker SC, Polley A, Raymond CK, Reichwald K, Rodriguez J, Sasaki T, Schilhabel M, Siddiqui R, Smith CL, Sneddon TP, Talamas JA, Tenzin P, Topham K, Venkataraman V, Wen G, Yamazaki S, Young SK, Zeng Q, Zimmer AR, Rosenthal A, Birren BW, Platzer M, Shimizu N, Lander ES: DNA sequence and analysis of human chromosome 8. Nature. 2006 Jan 19;439(7074):331-5. [PubMed:16421571 ]
  4. Glavas NA, Ostenson C, Schaefer JB, Vasta V, Beavo JA: T cell activation up-regulates cyclic nucleotide phosphodiesterases 8A1 and 7A3. Proc Natl Acad Sci U S A. 2001 May 22;98(11):6319-24. [PubMed:11371644 ]
  5. Michaeli T, Bloom TJ, Martins T, Loughney K, Ferguson K, Riggs M, Rodgers L, Beavo JA, Wigler M: Isolation and characterization of a previously undetected human cAMP phosphodiesterase by complementation of cAMP phosphodiesterase-deficient Saccharomyces cerevisiae. J Biol Chem. 1993 Jun 15;268(17):12925-32. [PubMed:8389765 ]
  6. Han P, Zhu X, Michaeli T: Alternative splicing of the high affinity cAMP-specific phosphodiesterase (PDE7A) mRNA in human skeletal muscle and heart. J Biol Chem. 1997 Jun 27;272(26):16152-7. [PubMed:9195912 ]
  7. Asirvatham AL, Galligan SG, Schillace RV, Davey MP, Vasta V, Beavo JA, Carr DW: A-kinase anchoring proteins interact with phosphodiesterases in T lymphocyte cell lines. J Immunol. 2004 Oct 15;173(8):4806-14. [PubMed:15470020 ]
  8. Wang H, Liu Y, Chen Y, Robinson H, Ke H: Multiple elements jointly determine inhibitor selectivity of cyclic nucleotide phosphodiesterases 4 and 7. J Biol Chem. 2005 Sep 2;280(35):30949-55. Epub 2005 Jul 1. [PubMed:15994308 ]
  9. Castano T, Wang H, Campillo NE, Ballester S, Gonzalez-Garcia C, Hernandez J, Perez C, Cuenca J, Perez-Castillo A, Martinez A, Huertas O, Gelpi JL, Luque FJ, Ke H, Gil C: Synthesis, structural analysis, and biological evaluation of thioxoquinazoline derivatives as phosphodiesterase 7 inhibitors. ChemMedChem. 2009 May;4(5):866-76. doi: 10.1002/cmdc.200900043. [PubMed:19350606 ]