Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP00599
Secondary Accession Numbers
  • 5871
Name AMP deaminase 2
Synonyms
  1. AMP deaminase isoform L
Gene Name AMPD2
Protein Type Enzyme
Biological Properties
General Function Involved in deaminase activity
Specific Function AMP deaminase plays a critical role in energy metabolism.
Pathways
  • IMP biosynthesis via salvage pathway
  • Purine metabolism
Reactions
Adenosine monophosphate + Water → Inosinic acid + Ammonia details
GO Classification
Biological Process
purine nucleobase metabolic process
purine-containing compound salvage
IMP salvage
purine nucleotide metabolic process
Cellular Component
cytosol
Function
catalytic activity
hydrolase activity
hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds
hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in cyclic amidines
amp deaminase activity
deaminase activity
Molecular Function
metal ion binding
AMP deaminase activity
Process
purine nucleotide metabolic process
purine nucleotide biosynthetic process
metabolic process
nitrogen compound metabolic process
cellular nitrogen compound metabolic process
nucleobase, nucleoside, nucleotide and nucleic acid metabolic process
nucleobase, nucleoside and nucleotide metabolic process
nucleoside phosphate metabolic process
nucleotide metabolic process
cellular aromatic compound metabolic process
purine nucleoside monophosphate biosynthetic process
purine ribonucleoside monophosphate biosynthetic process
purine base metabolic process
cellular metabolic process
nucleobase metabolic process
Cellular Location
  1. Cytoplasmic
Gene Properties
Chromosome Location 1
Locus 1p13.3
SNPs AMPD2
Gene Sequence
>2640 bp
ATGAGAAATCGTGGCCAGGGCCTCTTCCGCCTGCGGAGCCGCTGCTTCCTGCATCAGTCA
CTCCCGCTGGGGGCGGGGCGGAGGAAGGGGTTGGATGTGGCAGAGCCAGGCCCCAGCCGG
TGCCGCTCAGACTCCCCCGCTGTCGCCGCCGTGGTCCCAGCCATGGCATCCTATCCATCT
GGCTCTGGCAAGCCCAAGGCCAAATATCCCTTTAAGAAGCGGGCCAGCCTGCAGGCCTCC
ACTGCAGCTCCAGAGGCTCGGGGTGGTCTGGGGGCCCCTCCGCTGCAGTCTGCCCGATCC
CTGCCGGGCCCCGCCCCCTGCCTCAAGCACTTCCCGCTCGACCTGCGCACGTCTATGGAT
GGCAAATGCAAGGAGATCGCCGAGGAGCTGTTCACCCGCTCACTGGCTGAGAGCGAGCTC
CGTAGTGCCCCGTATGAGTTCCCCGAGGAGAGCCCCATTGAACAGCTGGAGGAGCGGCGG
CAGCGGCTGGAGCGGCAGATCAGCCAGGATGTCAAGCTGGAGCCAGACATCCTGCTTCGG
GCCAAGCAAGATTTCCTGAAGACGGACAGTGACTCGGACCTACAGCTCTACAAGGAACAG
GGTGAGGGGCAGGGTGACCGGAGCCTGCGGGAGCGTGATGTGCTGGAACGGGAGTTTCAG
CGGGTCACCATCTCTGGGGAGGAGAAGTGTGGGGTGCCGTTCACAGACCTGCTGGATGCA
GCCAAGAGTGTGGTGCGGGCGCTCTTCATCCGGGAGAAGTACATGGCCCTGTCCCTGCAG
AGCTTCTGCCCCACCACCCGCCGCTACCTGCAGCAGCTGGCTGAAAAGCCTCTGGAGACC
CGGACCTATGAACAGGGCCCCGACACCCCTGTGTCTGCTGATGCCCCGGTGCACCCCCCT
GCGCTGGAGCAGCACCCGTATGAGCACTGTGAGCCAAGCACCATGCCTGGGGACCTGGGC
TTGGGTCTGCGCATGGTGCGGGGTGTGGTGCACGTCTACACCCGCAGGGAACCCGACGAG
CATTGCTCAGAGGTGGAGCTGCCATACCCTGACCTGCAGGAATTTGTGGCTGACGTCAAT
GTGCTGATGGCCCTGATTATCAATGGCCCCATAAAGTCATTCTGCTACCGCCGGCTGCAG
TACCTGAGCTCCAAGTTCCAGATGCATGTGCTACTCAATGAGATGAAGGAGCTGGCCGCC
CAGAAGAAAGTGCCACACCGAGATTTCTACAACATCCGCAAGGTGGACACCCACATCCAT
GCCTCGTCCTGCATGAACCAGAAGCATCTGCTGCGCTTCATCAAGCGGGCAATGAAGCGG
CACCTGGAGGAGATCGTGCACGTGGAGCAGGGCCGTGAACAGACGCTGCGGGAGGTCTTT
GAGAGCATGAATCTCACGGCCTACGACCTGAGTGTGGACACGCTGGATGTGCATGCGGAC
AGGAACACTTTCCATCGCTTTGACAAGTTTAATGCCAAATACAACCCTATTGGGGAGTCC
GTCCTCCGAGAGATCTTCATCAAGACGGACAACAGGGTATCTGGGAAGTACTTTGCTCAC
ATCATCAAGGAGGTGATGTCAGACCTGGAGGAGAGCAAATACCAGAATGCAGAGCTGCGG
CTCTCCATTTACGGGCGCTCGAGGGATGAGTGGGACAAGCTGGCGCGCTGGGCCGTCATG
CACCGCGTGCACTCCCCCAACGTGCGCTGGCTGGTGCAGGTGCCCCGCCTCTTTGATGTG
TACCGTACCAAGGGCCAGCTGGCCAACTTCCAGGAGATGCTGGAGAACATCTTCCTGCCA
CTGTTCGAGGCCACTGTGCACCCTGCCAGCCACCCGGAACTGCATCTCTTCTTAGAGCAC
GTGGATGGTTTTGACAGCGTGGATGATGAGTCCAAGCCTGAAAACCATGTCTTCAACCTG
GAGAGCCCCCTGCCTGAGGCGTGGGTGGAGGAGGACAACCCACCCTATGCCTACTACCTG
TACTACACCTTTGCCAACATGGCCATGTTGAACCACCTGCGCAGGCAGAGGGGCTTCCAC
ACGTTTGTGCTGAGGCCACACTGTGGGGAGGCTGGGCCCATCCACCACCTGGTGTCAGCC
TTCATGCTGGCTGAGAACATTTCCCACGGGCTCCTTCTGCGCAAGGCCCCCGTCCTGCAG
TACCTGTACTACCTGGCCCAGATCGGCATCGCCATGTCTCCGCTCAGCAACAACAGCCTC
TTCCTCAGCTATCACCGGAATCCGCTACCGGAGTACCTGTCCCGCGGCCTCATGGTCTCC
CTGTCCACTGATGATCCCTTGCAGTTCCACTTCACCAAGGAGCCGCTGATGGAGGAGTAC
AGCATCGCCACCCAGGTGTGGAAGCTCAGCTCCTGCGATATGTGTGAGCTGGCCCGCAAC
AGCGTGCTCATGAGCGGCTTCTCGCACAAGGTAAAGAGCCACTGGCTGGGACCCAACTAT
ACCAAGGAAGGCCCTGAGGGGAATGACATCCGCCGGACCAATGTGCCAGACATCCGCGTG
GGCTACCGCTACGAGACCCTGTGCCAGGAGCTGGCGCTCATCACGCAGGCAGTCCAGAGT
GAGATGCTGGAGACCATTCCAGAGGAGGCGGGTATCACCATGAGCCCAGGGCCTCAATGA
Protein Properties
Number of Residues 879
Molecular Weight 100686.95
Theoretical pI 6.933
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>AMP deaminase 2
MRNRGQGLFRLRSRCFLHQSLPLGAGRRKGLDVAEPGPSRCRSDSPAVAAVVPAMASYPS
GSGKPKAKYPFKKRASLQASTAAPEARGGLGAPPLQSARSLPGPAPCLKHFPLDLRTSMD
GKCKEIAEELFTRSLAESELRSAPYEFPEESPIEQLEERRQRLERQISQDVKLEPDILLR
AKQDFLKTDSDSDLQLYKEQGEGQGDRSLRERDVLEREFQRVTISGEEKCGVPFTDLLDA
AKSVVRALFIREKYMALSLQSFCPTTRRYLQQLAEKPLETRTYEQGPDTPVSADAPVHPP
ALEQHPYEHCEPSTMPGDLGLGLRMVRGVVHVYTRREPDEHCSEVELPYPDLQEFVADVN
VLMALIINGPIKSFCYRRLQYLSSKFQMHVLLNEMKELAAQKKVPHRDFYNIRKVDTHIH
ASSCMNQKHLLRFIKRAMKRHLEEIVHVEQGREQTLREVFESMNLTAYDLSVDTLDVHAD
RNTFHRFDKFNAKYNPIGESVLREIFIKTDNRVSGKYFAHIIKEVMSDLEESKYQNAELR
LSIYGRSRDEWDKLARWAVMHRVHSPNVRWLVQVPRLFDVYRTKGQLANFQEMLENIFLP
LFEATVHPASHPELHLFLEHVDGFDSVDDESKPENHVFNLESPLPEAWVEEDNPPYAYYL
YYTFANMAMLNHLRRQRGFHTFVLRPHCGEAGPIHHLVSAFMLAENISHGLLLRKAPVLQ
YLYYLAQIGIAMSPLSNNSLFLSYHRNPLPEYLSRGLMVSLSTDDPLQFHFTKEPLMEEY
SIATQVWKLSSCDMCELARNSVLMSGFSHKVKSHWLGPNYTKEGPEGNDIRRTNVPDIRV
GYRYETLCQELALITQAVQSEMLETIPEEAGITMSPGPQ
GenBank ID Protein 21264318
UniProtKB/Swiss-Prot ID Q01433
UniProtKB/Swiss-Prot Entry Name AMPD2_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_004037.6
GeneCard ID AMPD2
GenAtlas ID AMPD2
HGNC ID HGNC:469
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [PubMed:16710414 ]
  4. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. [PubMed:19608861 ]
  5. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  6. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  7. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  8. Imami K, Sugiyama N, Kyono Y, Tomita M, Ishihama Y: Automated phosphoproteome analysis for cultured cancer cells by two-dimensional nanoLC-MS using a calcined titania/C18 biphasic column. Anal Sci. 2008 Jan;24(1):161-6. [PubMed:18187866 ]
  9. Zahedi RP, Lewandrowski U, Wiesner J, Wortelkamp S, Moebius J, Schutz C, Walter U, Gambaryan S, Sickmann A: Phosphoproteome of resting human platelets. J Proteome Res. 2008 Feb;7(2):526-34. Epub 2007 Dec 19. [PubMed:18088087 ]
  10. Beausoleil SA, Villen J, Gerber SA, Rush J, Gygi SP: A probability-based approach for high-throughput protein phosphorylation analysis and site localization. Nat Biotechnol. 2006 Oct;24(10):1285-92. Epub 2006 Sep 10. [PubMed:16964243 ]
  11. Bausch-Jurken MT, Mahnke-Zizelman DK, Morisaki T, Sabina RL: Molecular cloning of AMP deaminase isoform L. Sequence and bacterial expression of human AMPD2 cDNA. J Biol Chem. 1992 Nov 5;267(31):22407-13. [PubMed:1429593 ]
  12. Van den Bergh F, Sabina RL: Characterization of human AMP deaminase 2 (AMPD2) gene expression reveals alternative transcripts encoding variable N-terminal extensions of isoform L. Biochem J. 1995 Dec 1;312 ( Pt 2):401-10. [PubMed:8526848 ]
  13. Mahnke-Zizelman DK, van den Bergh F, Bausch-Jurken MT, Eddy R, Sait S, Shows TB, Sabina RL: Cloning, sequence and characterization of the human AMPD2 gene: evidence for transcriptional regulation by two closely spaced promoters. Biochim Biophys Acta. 1996 Aug 14;1308(2):122-32. [PubMed:8764830 ]