You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP00642
Secondary Accession Numbers
  • 5914
Name Probable histidine--tRNA ligase, mitochondrial
Synonyms
  1. HisRS
  2. Histidine--tRNA ligase
  3. Histidine--tRNA ligase-like
  4. Histidyl-tRNA synthetase
Gene Name HARS2
Protein Type Enzyme
Biological Properties
General Function Involved in nucleotide binding
Specific Function Not Available
Pathways
  • Aminoacyl-tRNA biosynthesis
  • Histidine Metabolism
  • Histidinemia
Reactions
Adenosine triphosphate + L-Histidine + tRNA(His) → Adenosine monophosphate + Pyrophosphate + L-histidyl-tRNA(His) details
Adenosine triphosphate + L-Histidine + tRNA(His) → Adenosine monophosphate + Pyrophosphate + L-Histidyl-tRNA(His) details
GO Classification
Biological Process
histidyl-tRNA aminoacylation
tRNA aminoacylation for protein translation
Cellular Component
mitochondrial matrix
Component
cell part
intracellular part
cytoplasm
Function
binding
nucleotide binding
catalytic activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
ligase activity
histidine-trna ligase activity
ligase activity, forming carbon-oxygen bonds
ligase activity, forming aminoacyl-trna and related compounds
aminoacyl-trna ligase activity
Molecular Function
ATP binding
histidine-tRNA ligase activity
Process
rna metabolic process
ncrna metabolic process
trna metabolic process
trna aminoacylation
trna aminoacylation for protein translation
macromolecule biosynthetic process
cellular macromolecule biosynthetic process
translation
metabolic process
macromolecule metabolic process
cellular macromolecule metabolic process
histidyl-trna aminoacylation
biosynthetic process
Cellular Location
  1. Mitochondrion matrix
Gene Properties
Chromosome Location 5
Locus 5q31.3
SNPs HARS2
Gene Sequence
>1521 bp
ATGCCCCTGCTCGGACTTCTTCCCAGGAGGGCCTGGGCTTCGCTGCTCAGCCAGCTCCTG
CGACCGCCCTGCGCTTCGTGCACCGGGGCGGTCCGTTGCCAAAGCCAGGTTGCAGAGGCA
GTGTTAACATCCCAACTGAAAGCACATCAAGAGAAACCAAATTTTATTATCAAGACCCCA
AAGGGTACCAGGGATCTTAGTCCTCAGCATATGGTTGTGAGGGAGAAAATTCTTGATTTG
GTTATCAGCTGCTTTAAACGTCATGGAGCAAAGGGGATGGACACCCCAGCATTTGAGCTG
AAGGAAACCCTGACTGAGAAGTATGGAGAGGACTCTGGGCTCATGTATGATCTGAAGGAT
CAAGGTGGAGAGCTGTTGTCCCTCCGCTATGACCTTACTGTTCCCTTTGCTCGTTATCTG
GCCATGAATAAGGTGAAGAAGATGAAACGTTATCATGTTGGAAAGGTGTGGCGGCGAGAG
AGCCCAACCATAGTCCAAGGCCGTTATAGGGAGTTCTGCCAGTGTGATTTTGACATTGCT
GGTCAGTTTGACCCTATGATCCCCGATGCAGAGTGTTTGAAGATCATGTGTGAAATCCTA
AGTGGATTGCAGTTGGGAGACTTTCTCATTAAGGTAAATGACCGGCGGATTGTGGATGGG
ATGTTTGCTGTCTGTGGTGTTCCTGAAAGCAAGTTCCGTGCCATCTGCTCCTCCATAGAT
AAACTAGACAAGATGGCTTGGAAAGATGTGAGACATGAGATGGTGGTGAAGAAAGGCCTG
GCTCCTGAGGTGGCTGATCGAATTGGGGACTATGTCCAGTGTCATGGTGGGGTATCCCTA
GTAGAGCAAATGTTTCAGGATCCCAGACTATCCCAGAACAAGCAGGCCCTGGAGGGCCTG
GGAGACCTAAAGCTGCTATTTGAATACCTGACTTTATTTGGAATTGCTGATAAGATCTCC
TTTGACCTCAGCCTGGCTCGGGGCCTAGACTACTATACAGGAGTGATCTATGAAGCAGTG
CTGCTGCAGACCCCAACTCAGGCTGGGGAGGAGCCCCTGAATGTGGGCAGTGTGGCTGCT
GGTGGGCGCTATGATGGGCTGGTGGGCATGTTTGACCCCAAGGGCCACAAGGTGCCATGT
GTGGGACTCAGCATTGGGGTTGAGCGAATCTTCTACATTGTGGAGCAGAGGATGAAGACC
AAAGGTGAGAAGGTGCGGACTACAGAGACTCAAGTGTTTGTGGCCACACCACAGAAGAAC
TTTCTCCAAGAACGGTTGAAGCTTATTGCAGAGCTTTGGGATTCTGGAATCAAGGCAGAG
ATGCTATACAAGAACAACCCCAAACTATTAACCCAGCTGCACTATTGTGAGAGCACAGGC
ATTCCACTGGTGGTCATTATTGGTGAGCAAGAACTGAAAGAAGGGGTCATCAAGATCCGT
TCAGTGGCCAGCAGAGAGGAGGTGGCCATTAAACGGGAAAATTTTGTGGCTGAAATTCAG
AAGCGACTGTCTGAGTCTTGA
Protein Properties
Number of Residues 506
Molecular Weight 56887.865
Theoretical pI 8.236
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Probable histidyl-tRNA synthetase, mitochondrial
MPLLGLLPRRAWASLLSQLLRPPCASCTGAVRCQSQVAEAVLTSQLKAHQEKPNFIIKTP
KGTRDLSPQHMVVREKILDLVISCFKRHGAKGMDTPAFELKETLTEKYGEDSGLMYDLKD
QGGELLSLRYDLTVPFARYLAMNKVKKMKRYHVGKVWRRESPTIVQGRYREFCQCDFDIA
GQFDPMIPDAECLKIMCEILSGLQLGDFLIKVNDRRIVDGMFAVCGVPESKFRAICSSID
KLDKMAWKDVRHEMVVKKGLAPEVADRIGDYVQCHGGVSLVEQMFQDPRLSQNKQALEGL
GDLKLLFEYLTLFGIADKISFDLSLARGLDYYTGVIYEAVLLQTPTQAGEEPLNVGSVAA
GGRYDGLVGMFDPKGHKVPCVGLSIGVERIFYIVEQRMKTKGEKVRTTETQVFVATPQKN
FLQERLKLIAELWDSGIKAEMLYKNNPKLLTQLHYCESTGIPLVVIIGEQELKEGVIKIR
SVASREEVAIKRENFVAEIQKRLSES
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID P49590
UniProtKB/Swiss-Prot Entry Name SYHM_HUMAN
PDB IDs Not Available
GenBank Gene ID U18937
GeneCard ID HARS2
GenAtlas ID HARS2
HGNC ID HGNC:4817
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. [PubMed:19608861 ]
  3. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  4. O'Hanlon TP, Raben N, Miller FW: A novel gene oriented in a head-to-head configuration with the human histidyl-tRNA synthetase (HRS) gene encodes an mRNA that predicts a polypeptide homologous to HRS. Biochem Biophys Res Commun. 1995 May 16;210(2):556-66. [PubMed:7755634 ]