You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP00661
Secondary Accession Numbers
  • 5933
Name Putative adenosylhomocysteinase 3
Synonyms
  1. AdoHcyase 3
  2. S-adenosyl-L-homocysteine hydrolase 3
  3. S-adenosylhomocysteine hydrolase-like protein 2
Gene Name AHCYL2
Protein Type Unknown
Biological Properties
General Function Involved in adenosylhomocysteinase activity
Specific Function Not Available
Pathways
  • Cysteine and methionine metabolism
  • L-homocysteine biosynthesis
Reactions
S-Adenosylhomocysteine + Water → Homocysteine + Adenosine details
Se-Adenosylselenohomocysteine + Water → Adenosine + Selenohomocysteine details
GO Classification
Biological Process
one-carbon metabolic process
Function
catalytic activity
hydrolase activity
hydrolase activity, acting on ether bonds
trialkylsulfonium hydrolase activity
adenosylhomocysteinase activity
Molecular Function
adenosylhomocysteinase activity
nucleotide binding
Process
metabolic process
cellular metabolic process
one-carbon metabolic process
Cellular Location
  1. Cytoplasmic
Gene Properties
Chromosome Location 7
Locus 7q32.1
SNPs AHCYL2
Gene Sequence
>1836 bp
ATGTCGGTGCAGGTTGTGTCAGCCGCGGCTGCCGCCAAGGTGCCTGAGGTGGAGCTGAAG
GACCTGAGCCCCTCCGAGGCGGAGTCGCAACTAGGACTGAGCACGGCCGCCGTGGGCGCC
ATGGCCCCCCCGGCGGGCGGTGGAGACCCTGAGGCTCCAGCTCCCGCCGCGGAGCGGCCC
CCGGTCCCCGGCCCGGGCTCGGGGCCCGCCGCCGCTCTCAGCCCCGCCGCCGGGAAGGTG
CCTCAGGCGTCGGCCATGAAGCGGAGCGACCCACATCACCAGCACCAGCGGCACCGCGAC
GGCGGCGAGGCCCTGGTCAGCCCCGACGGCACCGTCACCGAGGCGCCGCGCACAGTCAAG
AAGCAGATCCAGTTTGCTGACCAGAAGCAAGAATTCAACAAACGTCCCACCAAAATTGGA
CGTCGCTCTTTGTCTCGTTCCATTTCTCAGTCATCTACTGACAGCTACAGCTCAGCGGCT
TCATATACAGATAGCTCTGATGATGAGACATCGCCCAGGGACAAGCAGCAAAAGAACTCT
AAGGGAAGCAGTGACTTCTGTGTTAAGAACATCAAACAGGCAGAGTTTGGACGAAGAGAA
ATTGAAATTGCTGAACAAGAAATGCCTGCATTGATGGCTTTGAGGAAGAGAGCTCAAGGA
GAAAAGCCTTTGGCTGGAGCCAAAATCGTGGGTTGCACACACATCACTGCTCAGACTGCT
GTGCTTATGGAAACTCTGGGTGCTCTGGGGGCCCAGTGCCGATGGGCTGCCTGCAACATC
TATTCCACTCTCAATGAAGTGGCTGCTGCTCTAGCAGAAAGTGGATTTCCTGTTTTTGCC
TGGAAGGGAGAGTCAGAAGATGACTTTTGGTGGTGTATCGATAGATGTGTGAATGTGGAG
GGCTGGCAGCCAAACATGATCTTGGATGATGGAGGGGATCTTACCCACTGGATTTATAAA
AAGTATCCCAACATGTTTAAGAAAATCAAGGGCATAGTAGAGGAGAGTGTTACTGGAGTT
CACAGGCTGTACCAACTGTCCAAAGCTGGGAAGCTGTGTGTTCCAGCCATGAATGTCAAT
GACTCAGTCACCAAACAGAAATTTGACAACCTCTACTGTTGCCGTGAATCAATTCTTGAT
GGACTTAAAAGGACAACAGACATGATGTTTGGTGGAAAGCAAGTGGTAGTCTGTGGCTAT
GGAGAGGTGGGGAAAGGGTGCTGTGCTGCCCTGAAAGCCATGGGCTCCATTGTGTATGTA
ACTGAAATTGACCCCATCTGTGCCCTGCAAGCCTGTATGGATGGATTTCGACTGGTGAAA
TTAAATGAGGTCATCCGACAAGTGGACATTGTTATTACCTGTACAGGTAACAAGAATGTG
GTAACCAGAGAGCACTTGGACCGTATGAAGAATAGCTGCATCGTTTGTAACATGGGACAT
TCCAACACAGAGATTGACGTGGCGAGTCTGCGGACACCAGAACTGACCTGGGAGCGAGTG
AGATCTCAAGTTGACCATGTGATATGGCCTGATGGCAAGAGGATAGTACTGCTGGCAGAG
GGCCGCCTGCTGAACCTTAGCTGCTCCACAGTGCCTACATTTGTGCTCTCAATCACTGCT
ACTACTCAGGCTCTTGCCTTGATAGAGCTTTACAATGCTCCTGAGGGTCGCTATAAGCAG
GATGTCTACCTGTTGCCCAAGAAGATGGATGAGTATGTGGCCAGCCTACACCTGCCTACC
TTTGATGCCCACTTGACAGAGCTGACAGATGAACAGGCCAAGTATCTGGGACTCAACAAG
AATGGGCCCTTCAAGCCTAATTACTACAGGTATTAA
Protein Properties
Number of Residues 611
Molecular Weight 66592.445
Theoretical pI 7.36
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Putative adenosylhomocysteinase 3
MSVQVVSAAAAAKVPEVELKDLSPSEAESQLGLSTAAVGAMAPPAGGGDPEAPAPAAERP
PVPGPGSGPAAALSPAAGKVPQASAMKRSDPHHQHQRHRDGGEALVSPDGTVTEAPRTVK
KQIQFADQKQEFNKRPTKIGRRSLSRSISQSSTDSYSSAASYTDSSDDETSPRDKQQKNS
KGSSDFCVKNIKQAEFGRREIEIAEQEMPALMALRKRAQGEKPLAGAKIVGCTHITAQTA
VLMETLGALGAQCRWAACNIYSTLNEVAAALAESGFPVFAWKGESEDDFWWCIDRCVNVE
GWQPNMILDDGGDLTHWIYKKYPNMFKKIKGIVEESVTGVHRLYQLSKAGKLCVPAMNVN
DSVTKQKFDNLYCCRESILDGLKRTTDMMFGGKQVVVCGYGEVGKGCCAALKAMGSIVYV
TEIDPICALQACMDGFRLVKLNEVIRQVDIVITCTGNKNVVTREHLDRMKNSCIVCNMGH
SNTEIDVASLRTPELTWERVRSQVDHVIWPDGKRIVLLAEGRLLNLSCSTVPTFVLSITA
TTQALALIELYNAPEGRYKQDVYLLPKKMDEYVASLHLPTFDAHLTELTDEQAKYLGLNK
NGPFKPNYYRY
GenBank ID Protein 24308043
UniProtKB/Swiss-Prot ID Q96HN2
UniProtKB/Swiss-Prot Entry Name SAHH3_HUMAN
PDB IDs
GenBank Gene ID NM_015328.3
GeneCard ID AHCYL2
GenAtlas ID AHCYL2
HGNC ID HGNC:22204
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  3. Hillier LW, Fulton RS, Fulton LA, Graves TA, Pepin KH, Wagner-McPherson C, Layman D, Maas J, Jaeger S, Walker R, Wylie K, Sekhon M, Becker MC, O'Laughlin MD, Schaller ME, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Cordes M, Du H, Sun H, Edwards J, Bradshaw-Cordum H, Ali J, Andrews S, Isak A, Vanbrunt A, Nguyen C, Du F, Lamar B, Courtney L, Kalicki J, Ozersky P, Bielicki L, Scott K, Holmes A, Harkins R, Harris A, Strong CM, Hou S, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Leonard S, Rohlfing T, Rock SM, Tin-Wollam AM, Abbott A, Minx P, Maupin R, Strowmatt C, Latreille P, Miller N, Johnson D, Murray J, Woessner JP, Wendl MC, Yang SP, Schultz BR, Wallis JW, Spieth J, Bieri TA, Nelson JO, Berkowicz N, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Bedell JA, Mardis ER, Clifton SW, Chissoe SL, Marra MA, Raymond C, Haugen E, Gillett W, Zhou Y, James R, Phelps K, Iadanoto S, Bubb K, Simms E, Levy R, Clendenning J, Kaul R, Kent WJ, Furey TS, Baertsch RA, Brent MR, Keibler E, Flicek P, Bork P, Suyama M, Bailey JA, Portnoy ME, Torrents D, Chinwalla AT, Gish WR, Eddy SR, McPherson JD, Olson MV, Eichler EE, Green ED, Waterston RH, Wilson RK: The DNA sequence of human chromosome 7. Nature. 2003 Jul 10;424(6945):157-64. [PubMed:12853948 ]
  4. Nagase T, Ishikawa K, Suyama M, Kikuno R, Hirosawa M, Miyajima N, Tanaka A, Kotani H, Nomura N, Ohara O: Prediction of the coding sequences of unidentified human genes. XII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro. DNA Res. 1998 Dec 31;5(6):355-64. [PubMed:10048485 ]