You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP00668
Secondary Accession Numbers
  • 5941
  • HMDBP09332
Name Protein-arginine deiminase type-6
Synonyms
  1. Peptidylarginine deiminase VI
  2. Protein-arginine deiminase type VI
  3. Peptidyl arginine deiminase-like protein
  4. hPADVI
Gene Name PADI6
Protein Type Unknown
Biological Properties
General Function Involved in protein-arginine deiminase activity
Specific Function Catalyzes the deimination of arginine residues of proteins. May be involved in cytoskeletal reorganization in the egg and early embryo (By similarity).
Pathways Not Available
Reactions
Protein L-arginine + Water → protein L-citrulline + Ammonia details
GO Classification
Biological Process
peptidyl-citrulline biosynthetic process from peptidyl-arginine
Cellular Component
cytoplasm
nucleus
Component
cell part
intracellular part
cytoplasm
Function
ion binding
cation binding
metal ion binding
binding
catalytic activity
hydrolase activity
hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amidines
hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds
protein-arginine deiminase activity
calcium ion binding
Molecular Function
protein-arginine deiminase activity
calcium ion binding
Process
metabolic process
macromolecule metabolic process
peptidyl-arginine modification
peptidyl-citrulline biosynthetic process from peptidyl-arginine
macromolecule modification
protein modification process
peptidyl-amino acid modification
Cellular Location
  1. Cytoplasmic
  2. Nucleus
  3. Cytoplasm
Gene Properties
Chromosome Location 1
Locus 1p36.13
SNPs PADI6
Gene Sequence
>2085 bp
ATGGTCAGCGTGGAGGGCCGAGCCATGTCCTTCCAGAGTATCATCCACCTGTCCCTGGAC
AGCCCTGTCCATGCCGTTTGTGTGTTGGGCACAGAAATCTGCTTGGATCTCAGCGGGTGT
GCCCCCCAGAAGTGCCAGTGCTTCACCATCCATGGCTCTGGGAGGGTCTTGATCGATGTG
GCCAACACGGTGATTTCTGAGAAGGAGGACGCCACCATCTGGTGGCCCCTGTCTGATCCC
ACGTACGCCACAGTGAAGATGACATCGCCCAGCCCTTCCGTGGATGCGGATAAGGTCTCG
GTCACATACTATGGGCCCAACGAGGATGCCCCCGTGGGCACAGCTGTGCTGTACCTCACT
GGCATTGAGGTCTCTCTAGAGGTAGACATCTACCGCAATGGGCAAGTTGAGATGTCAAGT
GACAAACAGGCTAAGAAAAAATGGATCTGGGGTCCCAGCGGTTGGGGTGCCATCCTGCTT
GTGAATTGCAACCCTGCTGATGTGGGCCAGCAACTTGAGGACAAGAAAACCAAGAAAGTG
ATCTTTTCAGAGGAAATAACGAATCTGTCCCAGATGACTCTGAATGTCCAAGGCCCCAGC
TGTATCTTAAAGAAATATCGGCTAGTCCTCCATACCTCCAAGGAAGAGTCGAAGAAGGCG
AGAGTCTACTGGCCCCAAAAAGACAACTCCAGTACCTTTGAGTTGGTGCTGGGGCCCGAC
CAGCACGCCTATACCTTGGCCCTCCTCGGGAACCACTTGAAGGAGACTTTCTACGTTGAA
GCTATAGCATTCCCATCTGCCGAATTCTCAGGCCTCATCTCCTACTCTGTGTCCCTGGTG
GAGGAGTCTCAAGACCCGTCAATTCCAGAGACTGTGCTGTACAAAGACACGGTGGTGTTC
CGGGTGGCTCCCTGTGTCTTCATTCCCTGTACCCAGGTGCCTCTGGAGGTTTACCTGTGC
AGGGAGCTGCAGCTGCAGGGTTTTGTGGACACAGTGACGAAGCTGAGTGAGAAGAGCAAC
AGCCAGGTGGCATCTGTCTATGAGGACCCCAACCGCCTGGGCAGGTGGCTCCAGGATGAG
ATGGCCTTCTGCTACACCCAGGCTCCCCACAAGACAACGTCCTTGATCCTCGACACACCT
CAGGCCGCCGATCTCGATGAGTTCCCCATGAAGTACTCACTGAGCCCTGGTATTGGCTAC
ATGATCCAGGACACTGAGGACCATAAAGTGGCCAGCATGGATTCCATTGGGAACCTGATG
GTGTCCCCACCTGTCAAGGTCCAAGGGAAAGAGTACCCGCTGGGCAGAGTCCTCATTGGC
AGCAGCTTTTACCCCAGCGCAGAGGGCCGGGCCATGAGTAAGACCCTCCGAGACTTCCTC
TATGCCCAGCAGGTCCAAGCGCCGGTGGAGCTCTACTCAGATTGGCTAATGACTGGCCAC
GTGGATGAGTTCATGTGCTTCATCCCCACAGATGACAAGAATGAGGGCAAAAAGGGCTTC
CTGCTGCTCCTGGCCAGCCCCAGTGCCTGCTATAAACTGTTCCGAGAGAAACAGAAGGAA
GGCTATGGCGACGCTCTTCTGTTTGATGAGCTTAGAGCAGATCAGCTCCTGTCTAATGGA
AGGGAAGCCAAAACCATCGACCAACTTCTGGCTGATGAAAGCCTGAAGAAGCAGAATGAA
TACGTGGAGAAGTGCATTCACCTGAACCGTGACATCCTGAAGACGGAGCTGGGCCTGGTG
GAACAGGACATCATCGAGATTCCCCAGCTGTTCTGCTTGGAGAAGCTGACTAACATCCCC
TCTGACCAGCAGCCCAAGAGGTCCTTTGCGAGGCCATACTTCCCTGACCTGTTGCGGATG
ATTGTGATGGGCAAGAACCTGGGGATCCCCAAGCCTTTTGGGCCCCAAATCAAGGGGACC
TGCTGCCTGGAAGAAAAGATTTGCTGCTTGCTGGAGCCCCTGGGCTTCAAGTGCACCTTC
ATCAATGACTTTGACTGTTACCTGACAGAGGTCGGAGACATCTGTGCCTGTGCCAACATC
CGCCGGGTGCCCTTTGCCTTCAAATGGTGGAAGATGGTACCTTAG
Protein Properties
Number of Residues 686
Molecular Weight 77726.735
Theoretical pI 5.271
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Protein-arginine deiminase type-6
MSFQSIIHLSLDSPVHAVCVLGTEICLDLSGCAPQKCQCFTIHGSGRVLIDVANTVISEK
EDATIWWPLSDPTYATVKMTSPSPSVDADKVSVTYYGPNEDAPVGTAVLYLTGIEVSLEV
DIYRNGQVEMSSDKQAKKKWIWGPSGWGAILLVNCNPADVGQQLEDKKTKKVIFSEEITN
LSQMTLNVQGPSCILKKYRLVLHTSKEESKKARVYWPQKDNSSTFELVLGPDQHAYTLAL
LGNHLKETFYVEAIAFPSAEFSGLISYSVSLVEESQDPSIPETVLYKDTVVFRVAPCVFI
PCTQVPLEVYLCRELQLQGFVDTVTKLSEKSNSQVASVYEDPNRLGRWLQDEMAFCYTQA
PHKTTSLILDTPQAADLDEFPMKYSLSPGIGYMIQDTEDHKVASMDSIGNLMVSPPVKVQ
GKEYPLGRVLIGSSFYPSAEGRAMSKTLRDFLYAQQVQAPVELYSDWLMTGHVDEFMCFI
PTDDKNEGKKGFLLLLASPSACYKLFREKQKEGYGDALLFDELRADQLLSNGREAKTIDQ
LLADESLKKQNEYVEKCIHLNRDILKTELGLVEQDIIEIPQLFCLEKLTNIPSDQQPKRS
FARPYFPDLLRMIVMGKNLGIPKPFGPQIKGTCCLEEKICCLLEPLGFKCTFINDFDCYL
TEVGDICACANIRRVPFAFKWWKMVP
GenBank ID Protein 117414158
UniProtKB/Swiss-Prot ID Q6TGC4
UniProtKB/Swiss-Prot Entry Name PADI6_HUMAN
PDB IDs
GenBank Gene ID AY443100
GeneCard ID PADI6
GenAtlas ID PADI6
HGNC ID HGNC:20449
References
General References
  1. Chavanas S, Mechin MC, Takahara H, Kawada A, Nachat R, Serre G, Simon M: Comparative analysis of the mouse and human peptidylarginine deiminase gene clusters reveals highly conserved non-coding segments and a new human gene, PADI6. Gene. 2004 Apr 14;330:19-27. [PubMed:15087120 ]
  2. Zhang J, Dai J, Zhao E, Lin Y, Zeng L, Chen J, Zheng H, Wang Y, Li X, Ying K, Xie Y, Mao Y: cDNA cloning, gene organization and expression analysis of human peptidylarginine deiminase type VI. Acta Biochim Pol. 2004;51(4):1051-8. [PubMed:15625577 ]