You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP00684
Secondary Accession Numbers
  • 5957
Name Protein-arginine deiminase type-2
Synonyms
  1. PAD-H19
  2. Peptidylarginine deiminase II
  3. Protein-arginine deiminase type II
Gene Name PADI2
Protein Type Unknown
Biological Properties
General Function Involved in protein-arginine deiminase activity
Specific Function Catalyzes the deimination of arginine residues of proteins (By similarity).
Pathways Not Available
Reactions
Protein L-arginine + Water → protein L-citrulline + Ammonia details
GO Classification
Biological Process
peptidyl-citrulline biosynthetic process from peptidyl-arginine
Cellular Component
cytoplasm
Component
cell part
intracellular part
cytoplasm
Function
ion binding
cation binding
metal ion binding
binding
catalytic activity
hydrolase activity
hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amidines
hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds
protein-arginine deiminase activity
calcium ion binding
Molecular Function
protein-arginine deiminase activity
calcium ion binding
Process
metabolic process
macromolecule metabolic process
peptidyl-arginine modification
peptidyl-citrulline biosynthetic process from peptidyl-arginine
macromolecule modification
protein modification process
peptidyl-amino acid modification
Cellular Location
  1. Cytoplasm
Gene Properties
Chromosome Location 1
Locus 1p36.13
SNPs PADI2
Gene Sequence
>1998 bp
ATGCTGCGCGAGCGGACCGTGCGGCTGCAGTACGGGAGCCGCGTGGAGGCGGTGTACGTG
CTGGGCACCTACCTCTGGACCGATGTCTACAGCGCGGCCCCAGCCGGGGCCCAAACCTTC
AGCCTGAAGCACTCGGAACACGTGTGGGTGGAGGTGGTGCGTGATGGGGAGGCTGAGGAG
GTGGCCACCAATGGCAAGCAGCGCTGGCTTCTCTCGCCCAGCACCACCCTGCGGGTCACC
ATGAGCCAGGCGAGCACCGAGGCCAGCAGTGACAAGGTCACCGTCAACTACTATGACGAG
GAAGGGAGCATTCCCATCGACCAGGCGGGGCTCTTCCTCACAGCCATTGAGATCTCCCTG
GATGTGGACGCAGACCGGGATGGTGTGGTGGAGAAGAACAACCCAAAGAAGGCATCCTGG
ACCTGGGGCCCCGAGGGCCAGGGGGCCATCCTGCTGGTGAACTGTGACCGAGAGACACCC
TGGTTGCCCAAGGAGGACTGCCGTGATGAGAAGGTCTACAGCAAGGAAGATCTCAAGGAC
ATGTCCCAGATGATCCTGCGGACCAAAGGCCCCGACCGCCTCCCCGCCGGATACGAGATA
GTTCTGTACATTTCCATGTCAGACTCAGACAAAGTGGGCGTGTTCTACGTGGAGAACCCG
TTCTTCGGCCAACGCTATATCCACATCCTGGGCCGGCGGAAGCTCTACCATGTGGTCAAG
TACACGGGTGGCTCCGCGGAGCTGCTGTTCTTCGTGGAAGGCCTCTGTTTCCCCGACGAG
GGCTTCTCAGGCCTGGTCTCCATCCATGTCAGCCTGCTGGAGTACATGGCCCAGGACATT
CCCCTGACTCCCATCTTCACGGACACCGTGATATTCCGGATTGCTCCGTGGATCATGACC
CCCAACATCCTGCCTCCCGTGTCGGTGTTTGTGTGCTGCATGAAGGATAATTACCTGTTC
CTGAAAGAGGTGAAGAACCTTGTGGAGAAAACCAACTGTGAGCTGAAGGTCTGCTTCCAG
TACCTAAACCGAGGCGATCGCTGGATCCAGGATGAAATTGAGTTTGGCTACATCGAGGCC
CCCCATAAAGGCTTCCCCGTGGTGCTGGACTCTCCCCGAGATGGAAACCTAAAGGACTTC
CCTGTGAAGGAGCTCCTGGGCCCAGATTTTGGCTACGTGACCCGGGAGCCCCTCTTTGAG
TCTGTCACCAGCCTTGACTCATTTGGAAACCTGGAGGTCAGTCCCCCAGTGACCGTGAAC
GGCAAGACATACCCGCTTGGCCGCATCCTCATCGGGAGCAGCTTTCCTCTGTCTGGTGGT
CGGAGGATGACCAAGGTGGTGCGTGACTTCCTGAAGGCCCAGCAGGTGCAGGCGCCCGTG
GAGCTCTACTCAGACTGGCTGACTGTGGGCCACGTGGATGAGTTCATGTCCTTTGTCCCC
ATCCCCGGCACAAAGAAATTCCTGCTACTCATGGCCAGCACCTCGGCCTGCTACAAGCTC
TTCCGAGAGAAGCAGAAGGACGGCCATGGAGAGGCCATCATGTTCAAAGGCTTGGGTGGG
ATGAGCAGCAAGCGAATCACCATCAACAAGATTCTGTCCAACGAGAGCCTTGTGCAGGAG
AACCTGTACTTCCAGCGCTGCCTAGACTGGAACCGTGACATCCTCAAGAAGGAGCTGGGA
CTGACAGAGCAGGACATCATTGACCTGCCCGCTCTGTTCAAGATGGACGAGGACCACCGT
GCCAGAGCCTTCTTCCCAAACATGGTGAACATGATCGTGCTGGACAAGGACCTGGGCATC
CCCAAGCCATTCGGGCCACAGGTTGAGGAGGAATGCTGCCTGGAGATGCACGTGCGTGGC
CTCCTGGAGCCCCTGGGCCTCGAATGCACCTTCATCGACGACATTTCTGCCTACCACAAA
TTTCTGGGGGAAGTCCACTGTGGCACCAACGTCCGCAGGAAGCCCTTCACCTTCAAGTGG
TGGCACATGGTGCCCTGA
Protein Properties
Number of Residues 665
Molecular Weight 75563.35
Theoretical pI 5.595
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Protein-arginine deiminase type-2
MLRERTVRLQYGSRVEAVYVLGTYLWTDVYSAAPAGAQTFSLKHSEHVWVEVVRDGEAEE
VATNGKQRWLLSPSTTLRVTMSQASTEASSDKVTVNYYDEEGSIPIDQAGLFLTAIEISL
DVDADRDGVVEKNNPKKASWTWGPEGQGAILLVNCDRETPWLPKEDCRDEKVYSKEDLKD
MSQMILRTKGPDRLPAGYEIVLYISMSDSDKVGVFYVENPFFGQRYIHILGRRKLYHVVK
YTGGSAELLFFVEGLCFPDEGFSGLVSIHVSLLEYMAQDIPLTPIFTDTVIFRIAPWIMT
PNILPPVSVFVCCMKDNYLFLKEVKNLVEKTNCELKVCFQYLNRGDRWIQDEIEFGYIEA
PHKGFPVVLDSPRDGNLKDFPVKELLGPDFGYVTREPLFESVTSLDSFGNLEVSPPVTVN
GKTYPLGRILIGSSFPLSGGRRMTKVVRDFLKAQQVQAPVELYSDWLTVGHVDEFMSFVP
IPGTKKFLLLMASTSACYKLFREKQKDGHGEAIMFKGLGGMSSKRITINKILSNESLVQE
NLYFQRCLDWNRDILKKELGLTEQDIIDLPALFKMDEDHRARAFFPNMVNMIVLDKDLGI
PKPFGPQVEEECCLEMHVRGLLEPLGLECTFIDDISAYHKFLGEVHCGTNVRRKPFTFKW
WHMVP
GenBank ID Protein 122939159
UniProtKB/Swiss-Prot ID Q9Y2J8
UniProtKB/Swiss-Prot Entry Name PADI2_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_007365.2
GeneCard ID PADI2
GenAtlas ID PADI2
HGNC ID HGNC:18341
References
General References
  1. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [PubMed:16710414 ]
  2. Chavanas S, Mechin MC, Takahara H, Kawada A, Nachat R, Serre G, Simon M: Comparative analysis of the mouse and human peptidylarginine deiminase gene clusters reveals highly conserved non-coding segments and a new human gene, PADI6. Gene. 2004 Apr 14;330:19-27. [PubMed:15087120 ]
  3. Ishigami A, Ohsawa T, Asaga H, Akiyama K, Kuramoto M, Maruyama N: Human peptidylarginine deiminase type II: molecular cloning, gene organization, and expression in human skin. Arch Biochem Biophys. 2002 Nov 1;407(1):25-31. [PubMed:12392711 ]
  4. Nagase T, Ishikawa K, Suyama M, Kikuno R, Hirosawa M, Miyajima N, Tanaka A, Kotani H, Nomura N, Ohara O: Prediction of the coding sequences of unidentified human genes. XIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro. DNA Res. 1999 Feb 26;6(1):63-70. [PubMed:10231032 ]