You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP00687
Secondary Accession Numbers
  • 5960
  • HMDBP09331
Name Protein-arginine deiminase type-1
Synonyms
  1. Peptidylarginine deiminase I
  2. Protein-arginine deiminase type I
Gene Name PADI1
Protein Type Unknown
Biological Properties
General Function Involved in protein-arginine deiminase activity
Specific Function Catalyzes the deimination of arginine residues of proteins (By similarity).
Pathways Not Available
Reactions
Protein L-arginine + Water → protein L-citrulline + Ammonia details
GO Classification
Biological Process
peptidyl-citrulline biosynthetic process from peptidyl-arginine
Cellular Component
cytoplasm
Component
cell part
intracellular part
cytoplasm
Function
ion binding
cation binding
metal ion binding
binding
catalytic activity
hydrolase activity
hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amidines
hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds
protein-arginine deiminase activity
calcium ion binding
Molecular Function
protein-arginine deiminase activity
calcium ion binding
Process
metabolic process
macromolecule metabolic process
peptidyl-arginine modification
peptidyl-citrulline biosynthetic process from peptidyl-arginine
biopolymer metabolism
biopolymer modification
protein modification
physiological process
metabolism
macromolecule metabolism
macromolecule modification
protein modification process
peptidyl-amino acid modification
Cellular Location
  1. Cytoplasmic
  2. Cytoplasm
Gene Properties
Chromosome Location 1
Locus 1p36.13
SNPs PADI1
Gene Sequence
>1992 bp
ATGGCCCCAAAGAGAGTTGTGCAGCTGTCCCTGAAGATGCCTACCCATGCCGTGTGTGTG
GTGGGAGTCGAGGCACATGTGGACATTCACAGTGATGTGCCCAAGGGTGCCAACAGCTTC
AGGGTCTCTGGAAGCTCCGGGGTGGAGGTCTTCATGGTCTACAACCGCACACGTGTGAAA
GAGCCCATAGGCAAGGCCCGTTGGCCGCTAGACACTGATGCAGACATGGTCGTATCTGTG
GGCACAGCCAGTAAGGAATTAAAGGACTTCAAGGTGAGGGTCTCCTACTTTGGGGAGCAG
GAAGACCAAGCTCTGGGCCGCAGCGTGCTTTACCTCACTGGCGTCGATATTTCCCTTGAG
GTTGACACAGGCCGCACAGGCAAGGTGAAGAGGAGCCAAGGGGACAAGAAAACCTGGCGC
TGGGGCCCTGAGGGCTATGGGGCTATCTTGCTGGTGAACTGTGACCGGGACAATCACAGG
TCCGCGGAGCCTGACCTCACCCACAGCTGGCTGATGTCGCTGGCTGACCTGCAGGACATG
TCCCCAATGCTGCTGAGCTGCAATGGCCCCGACAAGCTCTTCGACAGCCACAAGCTTGTC
TTGAACGTGCCCTTTTCTGATTCCAAAAGAGTGAGGGTCTTCTGTGCCAGGGGTGGGAAT
TCTCTCTCGGACTACAAACAGGTGCTGGGGCCCCAGTGTCTGTCCTATGAAGTTGAGCGA
CAGCCAGGGGAGCAGGAGATCAAGTTCTATGTGGAGGGGCTGACCTTCCCCGATGCCGAT
TTCCTAGGGCTGGTTTCCCTCAGTGTCAGCCTGGTGGACCCGGGGACCCTGCCCGAGGTG
ACCCTCTTCACAGACACTGTGGGCTTCCGCATGGCCCCCTGGATCATGACGCCCAACACT
CAGCCTCCTGAGGAGCTGTATGTGTGCAGAGTGATGGACACTCATGGCTCCAATGAGAAA
TTCCTGGAGGACATGTCTTATCTGACATTGAAAGCCAACTGCAAGCTGACCATCTGCCCT
CAAGTTGAAAATCGAAATGACCGCTGGATCCAGGACGAGATGGAGTTTGGCTACATCGAG
GCCCCTCACAAATCCTTCCCCGTGGTCTTTGACTCCCCCAGGAACAGGGGCCTGAAAGAT
TTCCCCTATAAGAGGATCCTGGGTCCTGACTTTGGATATGTTACCCGGGAGATCCCGCTC
CCTGGTCCCTCCAGCCTTGACTCCTTCGGCAACCTGGACGTCAGCCCGCCCGTCACGGGG
GGCGGCACGGAATACCCCCTGGGCCGGATCCTCATCGGGAGCAGCTTCCCCAAGTCCGGT
GGGCGGCAGATGGCCAGGGCAGTGCGGAACTTCCTGAAGGCACAGCAGGTGCAGGCACCC
GTGGAGCTCTACTCGGACTGGCTCTCTGTGGGCCATGTGGACGAGTTTCTGACCTTTGTG
CCTACCTCTGACCAGAAGGGCTTCCGGCTGCTCCTGGCTAGCCCCAGCGCTTGCCCCAAA
CTCTTCCAAGAGAAGAAAGAAGAGGGTTATGGGGAGGCAGCCCAGTTTGATGGGTTAAAA
CACCAGGCAAAAAGAAGCATTAATGAGATGCTGGCAGACAGACACCTCCAGAGAGACAAT
CTTCATGCACAGAAATGCATTGACTGGAACCGTAATGTGCTGAAGCGGGAGCTGGGCCTG
GCAGAGAGTGACATCGTGGACATTCCCCAGCTCTTCTTCCTGAAAAACTTCTACGCGGAA
GCCTTCTTCCCAGACATGGTTAACATGGTGGTCTTAGGCAAGTACCTGGGCATCCCCAAG
CCCTACGGGCCCATCATCAATGGCCGCTGCTGCCTGGAGGAGAAGGTGCAGTCCCTGCTG
GAGCCTCTGGGCCTGCACTGCATCTTCATTGATGACTACTTGTCCTACCACGAGCTGCAG
GGGGAGATCCACTGTGGCACCAACGTGCGCAGGAAGCCCTTTCCCTTCAAATGGTGGAAC
ATGGTGCCCTGA
Protein Properties
Number of Residues 663
Molecular Weight 74664.97
Theoretical pI 6.498
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Protein-arginine deiminase type-1
MAPKRVVQLSLKMPTHAVCVVGVEAHVDIHSDVPKGANSFRVSGSSGVEVFMVYNRTRVK
EPIGKARWPLDTDADMVVSVGTASKELKDFKVRVSYFGEQEDQALGRSVLYLTGVDISLE
VDTGRTGKVKRSQGDKKTWRWGPEGYGAILLVNCDRDNHRSAEPDLTHSWLMSLADLQDM
SPMLLSCNGPDKLFDSHKLVLNVPFSDSKRVRVFCARGGNSLSDYKQVLGPQCLSYEVER
QPGEQEIKFYVEGLTFPDADFLGLVSLSVSLVDPGTLPEVTLFTDTVGFRMAPWIMTPNT
QPPEELYVCRVMDTHGSNEKFLEDMSYLTLKANCKLTICPQVENRNDRWIQDEMEFGYIE
APHKSFPVVFDSPRNRGLKDFPYKRILGPDFGYVTREIPLPGPSSLDSFGNLDVSPPVTV
GGTEYPLGRILIGSSFPKSGGRQMARAVRNFLKAQQVQAPVELYSDWLSVGHVDEFLTFV
PTSDQKGFRLLLASPSACLKLFQEKKEEGYGEAAQFDGLKHQAKRSINEMLADRHLQRDN
LHAQKCIDWNRNVLKRELGLAESDIVDIPQLFFLKNFYAEAFFPDMVNMVVLGKYLGIPK
PYGPIINGRCCLEEKVQSLLEPLGLHCIFIDDYLSYHELQGEIHCGTNVRRKPFPFKWWN
MVP
GenBank ID Protein 6116899
UniProtKB/Swiss-Prot ID Q9ULC6
UniProtKB/Swiss-Prot Entry Name PADI1_HUMAN
PDB IDs Not Available
GenBank Gene ID AB033768
GeneCard ID PADI1
GenAtlas ID PADI1
HGNC ID HGNC:18367
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [PubMed:16710414 ]
  3. Chavanas S, Mechin MC, Takahara H, Kawada A, Nachat R, Serre G, Simon M: Comparative analysis of the mouse and human peptidylarginine deiminase gene clusters reveals highly conserved non-coding segments and a new human gene, PADI6. Gene. 2004 Apr 14;330:19-27. [PubMed:15087120 ]
  4. Guerrin M, Ishigami A, Mechin MC, Nachat R, Valmary S, Sebbag M, Simon M, Senshu T, Serre G: cDNA cloning, gene organization and expression analysis of human peptidylarginine deiminase type I. Biochem J. 2003 Feb 15;370(Pt 1):167-74. [PubMed:12416996 ]
  5. Strausberg RL, Feingold EA, Grouse LH, Derge JG, Klausner RD, Collins FS, Wagner L, Shenmen CM, Schuler GD, Altschul SF, Zeeberg B, Buetow KH, Schaefer CF, Bhat NK, Hopkins RF, Jordan H, Moore T, Max SI, Wang J, Hsieh F, Diatchenko L, Marusina K, Farmer AA, Rubin GM, Hong L, Stapleton M, Soares MB, Bonaldo MF, Casavant TL, Scheetz TE, Brownstein MJ, Usdin TB, Toshiyuki S, Carninci P, Prange C, Raha SS, Loquellano NA, Peters GJ, Abramson RD, Mullahy SJ, Bosak SA, McEwan PJ, McKernan KJ, Malek JA, Gunaratne PH, Richards S, Worley KC, Hale S, Garcia AM, Gay LJ, Hulyk SW, Villalon DK, Muzny DM, Sodergren EJ, Lu X, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madan A, Young AC, Shevchenko Y, Bouffard GG, Blakesley RW, Touchman JW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Krzywinski MI, Skalska U, Smailus DE, Schnerch A, Schein JE, Jones SJ, Marra MA: Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences. Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11. [PubMed:12477932 ]