Canmetcon
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP00690
Secondary Accession Numbers
  • 5963
  • HMDBP09333
Name Guanine deaminase
Synonyms
  1. GAH
  2. Guanase
  3. Guanine aminase
  4. Guanine aminohydrolase
  5. p51-nedasin
Gene Name GDA
Protein Type Unknown
Biological Properties
General Function Involved in hydrolase activity
Specific Function Catalyzes the hydrolytic deamination of guanine, producing xanthine and ammonia (By similarity).
Pathways
  • Adenine phosphoribosyltransferase deficiency (APRT)
  • Adenosine Deaminase Deficiency
  • Adenylosuccinate Lyase Deficiency
  • AICA-Ribosiduria
  • Azathioprine Action Pathway
  • Beta Ureidopropionase Deficiency
  • Dihydropyrimidinase Deficiency
  • Gout or Kelley-Seegmiller Syndrome
  • guanine degradation
  • Lesch-Nyhan Syndrome (LNS)
  • Mercaptopurine Action Pathway
  • Mitochondrial DNA depletion syndrome
  • MNGIE (Mitochondrial Neurogastrointestinal Encephalopathy)
  • Molybdenum Cofactor Deficiency
  • Myoadenylate deaminase deficiency
  • Purine Metabolism
  • Purine metabolism
  • Purine Nucleoside Phosphorylase Deficiency
  • Pyrimidine Metabolism
  • Thioguanine Action Pathway
  • UMP Synthase Deficiency (Orotic Aciduria)
  • Xanthine Dehydrogenase Deficiency (Xanthinuria)
  • Xanthinuria type I
  • Xanthinuria type II
Reactions
Guanine + Water → Xanthine + Ammonia details
GO Classification
Biological Process
purine nucleobase metabolic process
purine nucleotide catabolic process
guanine catabolic process
nervous system development
Cellular Component
cytosol
Function
ion binding
cation binding
metal ion binding
binding
catalytic activity
hydrolase activity
hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds
transition metal ion binding
zinc ion binding
hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in cyclic amidines
guanine deaminase activity
Molecular Function
metal ion binding
guanine deaminase activity
zinc ion binding
Cellular Location
  1. Cytoplasmic
Gene Properties
Chromosome Location 9
Locus 9q21.13
SNPs GDA
Gene Sequence
>1365 bp
ATGTGTGCCGCTCAGATGCCGCCCCTGGCGCACATCTTCCGAGGGACGTTCGTCCACTCC
ACCTGGACCTGCCCCATGGAGGTGCTGCGGGATCACCTCCTCGGCGTGAGCGACAGCGGC
AAAATAGTGTTTTTAGAAGAAGCATCTCAACAGGAAAAACTGGCCAAAGAATGGTGCTTC
AAGCCGTGTGAAATAAGAGAACTGAGCCACCATGAGTTCTTCATGCCTGGGCTGGTTGAT
ACACACATCCATGCCTCTCAGTATTCCTTTGCTGGAAGTAGCATAGACCTGCCACTCTTG
GAGTGGCTGACCAAGTACACATTTCCTGCAGAACACAGATTCCAGAACATCGACTTTGCA
GAAGAAGTATATACCAGAGTTGTCAGGAGAACACTAAAGAATGGAACAACCACAGCTTGT
TACTTTGCAACAATTCACACTGACTCATCTCTGCTCCTTGCCGACATTACAGATAAATTT
GGACAGCGGGCATTTGTGGGCAAAGTTTGCATGGATTTGAATGACACTTTTCCAGAATAC
AAGGAGACCACTGAGGAATCGATCAAGGAAACTGAGAGATTTGTGTCAGAAATGCTCCAA
AAGAACTATTCTAGAGTGAAGCCCATAGTGACACCACGTTTTTCCCTCTCCTGCTCTGAG
ACTTTGATGGGTGAACTGGGCAACATTGCTAAAACCCGTGATTTGCACATTCAGAGCCAT
ATAAGTGAAAATCGTGATGAAGTTGAAGCTGTGAAAAACTTATACCCCAGTTATAAAAAC
TACACATCTGTGTATGATAAAAACAATCTTTTGACAAATAAGACAGTGATGGCACACGGC
TGCTACCTCTCTGCAGAAGAACTGAACGTATTCCATGAACGAGGAGCATCCATCGCACAC
TGTCCCAATTCTAATTTATCGCTCAGCAGTGGATTTCTAAATGTGCTAGAAGTCCTGAAA
CATGAAGTCAAGATAGGGCTGGGTACAGACGTGGCTGGTGGCTATTCATATTCCATGCTT
GATGCAATCAGAAGAGCAGTGATGGTTTCCAATATCCTTTTAATTAATAAGGTAAATGAG
AAAAGCCTCACCCTCAAAGAAGTCTTCAGACTAGCTACTCTTGGAGGAAGCCAAGCCCTG
GGGCTGGATGGTGAGATTGGAAACTTTGAAGTGGGCAAGGAATTTGATGCCATCCTGATC
AACCCCAAAGCATCCGACTCTCCCATTGACCTGTTTTATGGGGACTTTTTTGGTGATATT
TCTGAGGCTGTTATCCAGAAGTTCCTCTATCTAGGAGATGATCGAAATATTGAAGAGGTT
TATGTGGGCGGAAAGCAGGTGGTTCCGTTTTCCAGCTCAGTGTAA
Protein Properties
Number of Residues 454
Molecular Weight 52836.65
Theoretical pI 5.845
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Guanine deaminase
MCAAQMPPLAHIFRGTFVHSTWTCPMEVLRDHLLGVSDSGKIVFLEEASQQEKLAKEWCF
KPCEIRELSHHEFFMPGLVDTHIHASQYSFAGSSIDLPLLEWLTKYTFPAEHRFQNIDFA
EEVYTRVVRRTLKNGTTTACYFATIHTDSSLLLADITDKFGQRAFVGKVCMDLNDTFPEY
KETTEESIKETERFVSEMLQKNYSRVKPIVTPRFSLSCSETLMGELGNIAKTRDLHIQSH
ISENRDEVEAVKNLYPSYKNYTSVYDKNNLLTNKTVMAHGCYLSAEELNVFHERGASIAH
CPNSNLSLSSGFLNVLEVLKHEVKIGLGTDVAGGYSYSMLDAIRRAVMVSNILLINKVNE
KSLTLKEVFRLATLGGSQALGLDGEIGNFEVGKEFDAILINPKASDSPIDLFYGDFFGDI
SEAVIQKFLYLGDDRNIEEVYVGGKQVVPFSSSV
GenBank ID Protein 4758426
UniProtKB/Swiss-Prot ID Q9Y2T3
UniProtKB/Swiss-Prot Entry Name GUAD_HUMAN
PDB IDs
GenBank Gene ID NM_004293.3
GeneCard ID GDA
GenAtlas ID GDA
HGNC ID HGNC:4212
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Humphray SJ, Oliver K, Hunt AR, Plumb RW, Loveland JE, Howe KL, Andrews TD, Searle S, Hunt SE, Scott CE, Jones MC, Ainscough R, Almeida JP, Ambrose KD, Ashwell RI, Babbage AK, Babbage S, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beasley H, Beasley O, Bird CP, Bray-Allen S, Brown AJ, Brown JY, Burford D, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Chen Y, Clarke G, Clark SY, Clee CM, Clegg S, Collier RE, Corby N, Crosier M, Cummings AT, Davies J, Dhami P, Dunn M, Dutta I, Dyer LW, Earthrowl ME, Faulkner L, Fleming CJ, Frankish A, Frankland JA, French L, Fricker DG, Garner P, Garnett J, Ghori J, Gilbert JG, Glison C, Grafham DV, Gribble S, Griffiths C, Griffiths-Jones S, Grocock R, Guy J, Hall RE, Hammond S, Harley JL, Harrison ES, Hart EA, Heath PD, Henderson CD, Hopkins BL, Howard PJ, Howden PJ, Huckle E, Johnson C, Johnson D, Joy AA, Kay M, Keenan S, Kershaw JK, Kimberley AM, King A, Knights A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd C, Lloyd DM, Lovell J, Martin S, Mashreghi-Mohammadi M, Matthews L, McLaren S, McLay KE, McMurray A, Milne S, Nickerson T, Nisbett J, Nordsiek G, Pearce AV, Peck AI, Porter KM, Pandian R, Pelan S, Phillimore B, Povey S, Ramsey Y, Rand V, Scharfe M, Sehra HK, Shownkeen R, Sims SK, Skuce CD, Smith M, Steward CA, Swarbreck D, Sycamore N, Tester J, Thorpe A, Tracey A, Tromans A, Thomas DW, Wall M, Wallis JM, West AP, Whitehead SL, Willey DL, Williams SA, Wilming L, Wray PW, Young L, Ashurst JL, Coulson A, Blocker H, Durbin R, Sulston JE, Hubbard T, Jackson MJ, Bentley DR, Beck S, Rogers J, Dunham I: DNA sequence and analysis of human chromosome 9. Nature. 2004 May 27;429(6990):369-74. [PubMed:15164053 ]
  3. Yuan G, Bin JC, McKay DJ, Snyder FF: Cloning and characterization of human guanine deaminase. Purification and partial amino acid sequence of the mouse protein. J Biol Chem. 1999 Mar 19;274(12):8175-80. [PubMed:10075721 ]
  4. Kuwahara H, Araki N, Makino K, Masuko N, Honda S, Kaibuchi K, Fukunaga K, Miyamoto E, Ogawa M, Saya H: A novel NE-dlg/SAP102-associated protein, p51-nedasin, related to the amidohydrolase superfamily, interferes with the association between NE-dlg/SAP102 and N-methyl-D-aspartate receptor. J Biol Chem. 1999 Nov 5;274(45):32204-14. [PubMed:10542258 ]
  5. Nagase T, Ishikawa K, Kikuno R, Hirosawa M, Nomura N, Ohara O: Prediction of the coding sequences of unidentified human genes. XV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro. DNA Res. 1999 Oct 29;6(5):337-45. [PubMed:10574462 ]