You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP00699
Secondary Accession Numbers
  • 5972
  • HMDBP04888
Name 3-oxo-5-alpha-steroid 4-dehydrogenase 1
Synonyms
  1. S5AR 1
  2. SR type 1
  3. Steroid 5-alpha-reductase 1
Gene Name SRD5A1
Protein Type Enzyme
Biological Properties
General Function Involved in 3-oxo-5-alpha-steroid 4-dehydrogenase activity
Specific Function Converts testosterone into 5-alpha-dihydrotestosterone and progesterone or corticosterone into their corresponding 5-alpha-3-oxosteroids. It plays a central role in sexual differentiation and androgen physiology.
Pathways
  • 17-Beta Hydroxysteroid Dehydrogenase III Deficiency
  • Androgen and Estrogen Metabolism
  • Aromatase deficiency
  • Steroid hormone biosynthesis
Reactions
A 3-oxo-5-alpha-steroid + NADP → a 3-oxo-Delta(4)-steroid + NADPH details
Androstanedione + Acceptor → Androstenedione + Reduced acceptor details
Dihydrotestosterone + Acceptor → Testosterone + Reduced acceptor details
GO Classification
Biological Process
small molecule metabolic process
response to follicle-stimulating hormone stimulus
hippocampus development
response to fungicide
thalamus development
hypothalamus development
cellular response to cAMP
response to growth hormone stimulus
cellular response to testosterone stimulus
cerebral cortex development
liver development
response to drug
cellular response to epinephrine stimulus
cellular response to estradiol stimulus
circadian sleep/wake cycle, REM sleep
diterpenoid metabolic process
response to muscle activity
sex determination
urogenital system development
cellular response to insulin stimulus
spinal cord development
female genitalia development
progesterone metabolic process
cell differentiation
cellular response to starvation
male gonad development
bone development
male genitalia development
serotonin metabolic process
cellular response to growth factor stimulus
pituitary gland development
cellular response to dexamethasone stimulus
androgen biosynthetic process
Cellular Component
endoplasmic reticulum membrane
perinuclear region of cytoplasm
cell body fiber
myelin sheath
neuronal cell body
integral to membrane
Component
membrane
cell part
intracellular part
cytoplasm
membrane part
intrinsic to membrane
integral to membrane
Function
oxidoreductase activity, acting on the ch-ch group of donors
catalytic activity
steroid dehydrogenase activity, acting on the ch-ch group of donors
3-oxo-5-alpha-steroid 4-dehydrogenase activity
oxidoreductase activity
steroid dehydrogenase activity
Molecular Function
electron carrier activity
amide binding
3-oxo-5-alpha-steroid 4-dehydrogenase activity
cholestenone 5-alpha-reductase activity
NADPH binding
Process
metabolic process
primary metabolic process
oxidation reduction
lipid metabolic process
steroid metabolic process
Cellular Location
  1. Multi-pass membrane protein (Potential)
  2. Endoplasmic reticulum membrane
  3. Multi-pass membrane protein
  4. Microsome membrane
Gene Properties
Chromosome Location 5
Locus 5p15
SNPs SRD5A1
Gene Sequence
>780 bp
ATGGCAACGGCGACGGGGGTGGCGGAGGAGCGCCTGCTGGCCGCGCTCGCCTACCTGCAG
TGCGCCGTGGGCTGCGCGGTCTTCGCGCGGAATCGTCAGACGAACTCAGTGTACGGCCGC
CACGCGCTGCCCAGCCACAGGCTCCGAGTGCCGGCGCGGGCCGCCTGGGTGGTGCAGGAG
CTGCCCTCGCTGGCCCTGCCGCTCTACCAGTACGCCAGCGAGTCCGCCCCGCGTCTCCGC
AGCGCGCCCAACTGCATCCTCCTGGCCATGTTCCTCGTCCACTACGGGCATCGGTGCTTA
ATTTACCCGTTTCTGATGCGAGGAGGAAAGCCTATGCCACTGTTGGCATGTACAATGGCG
ATTATGTTCTGTACCTGTAACGGCTATTTGCAAAGCAGATACTTGAGCCATTGTGCAGTG
TATGCTGATGACTGGGTAACAGATCCCCGTTTTCTAATAGGTTTTGGCTTGTGGTTAACA
GGCATGTTGATAAACATCCATTCAGATCATATCCTAAGGAATCTCAGAAAACCAGGAGAT
ACTGGATACAAAATACCAAGGGGAGGCTTATTTGAATACGTAACTGCAGCCAACTATTTT
GGAGAAATCATGGAGTGGTGTGGCTATGCCCTGGCCAGCTGGTCTGTCCAAGGCGCGGCT
TTTGCTTTCTTCACGTTTTGTTTTTTATCTGGTAGAGCAAAAGAGCATCATGAGTGGTAC
CTCCGGAAATTTGAAGAGTATCCAAAGTTCAGAAAAATTATAATTCCATTTTTGTTTTAA
Protein Properties
Number of Residues 259
Molecular Weight 29458.18
Theoretical pI 8.942
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>3-oxo-5-alpha-steroid 4-dehydrogenase 1
MATATGVAEERLLAALAYLQCAVGCAVFARNRQTNSVYGRHALPSHRLRVPARAAWVVQE
LPSLALPLYQYASESAPRLRSAPNCILLAMFLVHYGHRCLIYPFLMRGGKPMPLLACTMA
IMFCTCNGYLQSRYLSHCAVYADDWVTDPRFLIGFGLWLTGMLINIHSDHILRNLRKPGD
TGYKIPRGGLFEYVTAANYFGEIMEWCGYALASWSVQGAAFAFFTFCFLSGRAKEHHEWY
LRKFEEYPKFRKIIIPFLF
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID P18405
UniProtKB/Swiss-Prot Entry Name S5A1_HUMAN
PDB IDs Not Available
GenBank Gene ID M32313
GeneCard ID SRD5A1
GenAtlas ID SRD5A1
HGNC ID HGNC:11284
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Hu RM, Han ZG, Song HD, Peng YD, Huang QH, Ren SX, Gu YJ, Huang CH, Li YB, Jiang CL, Fu G, Zhang QH, Gu BW, Dai M, Mao YF, Gao GF, Rong R, Ye M, Zhou J, Xu SH, Gu J, Shi JX, Jin WR, Zhang CK, Wu TM, Huang GY, Chen Z, Chen MD, Chen JL: Gene expression profiling in the human hypothalamus-pituitary-adrenal axis and full-length cDNA cloning. Proc Natl Acad Sci U S A. 2000 Aug 15;97(17):9543-8. [PubMed:10931946 ]
  4. Andersson S, Russell DW: Structural and biochemical properties of cloned and expressed human and rat steroid 5 alpha-reductases. Proc Natl Acad Sci U S A. 1990 May;87(10):3640-4. [PubMed:2339109 ]
  5. Jenkins EP, Hsieh CL, Milatovich A, Normington K, Berman DM, Francke U, Russell DW: Characterization and chromosomal mapping of a human steroid 5 alpha-reductase gene and pseudogene and mapping of the mouse homologue. Genomics. 1991 Dec;11(4):1102-12. [PubMed:1686016 ]
  6. Eminovic I, Liovic M, Prezelj J, Kocijancic A, Rozman D, Komel R: New steroid 5alpha-reductase type I (SRD5A1) homologous sequences on human chromosomes 6 and 8. Pflugers Arch. 2001;442(6 Suppl 1):R187-9. [PubMed:11678334 ]