You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP00755
Secondary Accession Numbers
  • 6030
  • HMDBP05077
Name Choline-phosphate cytidylyltransferase A
Synonyms
  1. CCT A
  2. CCT-alpha
  3. CT A
  4. CTP:phosphocholine cytidylyltransferase A
  5. Phosphorylcholine transferase A
Gene Name PCYT1A
Protein Type Enzyme
Biological Properties
General Function Involved in catalytic activity
Specific Function Controls phosphatidylcholine synthesis.
Pathways
  • Glycerophospholipid metabolism
  • Lamivudine Metabolism Pathway
  • Phosphatidylcholine Biosynthesis
  • phosphatidylcholine biosynthesis
  • Phosphatidylcholine Biosynthesis PC(11D3/11D3)
  • Phosphatidylcholine Biosynthesis PC(11D3/11D5)
  • Phosphatidylcholine Biosynthesis PC(11D3/11M3)
  • Phosphatidylcholine Biosynthesis PC(11D3/11M5)
  • Phosphatidylcholine Biosynthesis PC(11D3/13D5)
  • Phosphatidylcholine Biosynthesis PC(11D3/13M5)
  • Phosphatidylcholine Biosynthesis PC(11D3/9D3)
  • Phosphatidylcholine Biosynthesis PC(11D3/9D5)
  • Phosphatidylcholine Biosynthesis PC(11D3/9M5)
  • Phosphatidylcholine Biosynthesis PC(11D5/11D3)
  • Phosphatidylcholine Biosynthesis PC(11D5/11D5)
  • Phosphatidylcholine Biosynthesis PC(11D5/11M3)
  • Phosphatidylcholine Biosynthesis PC(11D5/11M5)
  • Phosphatidylcholine Biosynthesis PC(11D5/13D5)
  • Phosphatidylcholine Biosynthesis PC(11D5/13M5)
  • Phosphatidylcholine Biosynthesis PC(11D5/9D3)
  • Phosphatidylcholine Biosynthesis PC(11D5/9D5)
  • Phosphatidylcholine Biosynthesis PC(11D5/9M5)
  • Phosphatidylcholine Biosynthesis PC(11M3/11D3)
  • Phosphatidylcholine Biosynthesis PC(11M3/11D5)
  • Phosphatidylcholine Biosynthesis PC(11M3/11M3)
  • Phosphatidylcholine Biosynthesis PC(11M3/11M5)
  • Phosphatidylcholine Biosynthesis PC(11M3/13D5)
  • Phosphatidylcholine Biosynthesis PC(11M3/13M5)
  • Phosphatidylcholine Biosynthesis PC(11M3/9D3)
  • Phosphatidylcholine Biosynthesis PC(11M3/9D5)
  • Phosphatidylcholine Biosynthesis PC(11M3/9M5)
  • Phosphatidylcholine Biosynthesis PC(11M5/11D3)
  • Phosphatidylcholine Biosynthesis PC(11M5/11D5)
  • Phosphatidylcholine Biosynthesis PC(11M5/11M3)
  • Phosphatidylcholine Biosynthesis PC(11M5/11M5)
  • Phosphatidylcholine Biosynthesis PC(11M5/13D5)
  • Phosphatidylcholine Biosynthesis PC(11M5/13M5)
  • Phosphatidylcholine Biosynthesis PC(11M5/9D3)
  • Phosphatidylcholine Biosynthesis PC(11M5/9D5)
  • Phosphatidylcholine Biosynthesis PC(11M5/9M5)
  • Phosphatidylcholine Biosynthesis PC(13D5/11D3)
  • Phosphatidylcholine Biosynthesis PC(13D5/11D5)
  • Phosphatidylcholine Biosynthesis PC(13D5/11M3)
  • Phosphatidylcholine Biosynthesis PC(13D5/11M5)
  • Phosphatidylcholine Biosynthesis PC(13D5/13D5)
  • Phosphatidylcholine Biosynthesis PC(13D5/13M5)
  • Phosphatidylcholine Biosynthesis PC(13D5/9D3)
  • Phosphatidylcholine Biosynthesis PC(13D5/9D5)
  • Phosphatidylcholine Biosynthesis PC(13D5/9M5)
  • Phosphatidylcholine Biosynthesis PC(13M5/11D3)
  • Phosphatidylcholine Biosynthesis PC(13M5/11D5)
  • Phosphatidylcholine Biosynthesis PC(13M5/11M3)
  • Phosphatidylcholine Biosynthesis PC(13M5/11M5)
  • Phosphatidylcholine Biosynthesis PC(13M5/13D5)
  • Phosphatidylcholine Biosynthesis PC(13M5/13M5)
  • Phosphatidylcholine Biosynthesis PC(13M5/9D3)
  • Phosphatidylcholine Biosynthesis PC(13M5/9D5)
  • Phosphatidylcholine Biosynthesis PC(13M5/9M5)
  • Phosphatidylcholine Biosynthesis PC(14:0/14:0)
  • Phosphatidylcholine Biosynthesis PC(14:0/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/15:0)
  • Phosphatidylcholine Biosynthesis PC(14:0/16:0)
  • Phosphatidylcholine Biosynthesis PC(14:0/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/18:0)
  • Phosphatidylcholine Biosynthesis PC(14:0/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/20:0)
  • Phosphatidylcholine Biosynthesis PC(14:0/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/22:0)
  • Phosphatidylcholine Biosynthesis PC(14:0/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(14:0/24:0)
  • Phosphatidylcholine Biosynthesis PC(14:0/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/14:0)
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/15:0)
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/16:0)
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/18:0)
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(14:1(9Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/14:0)
  • Phosphatidylcholine Biosynthesis PC(15:0/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/15:0)
  • Phosphatidylcholine Biosynthesis PC(15:0/16:0)
  • Phosphatidylcholine Biosynthesis PC(15:0/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/18:0)
  • Phosphatidylcholine Biosynthesis PC(15:0/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/20:0)
  • Phosphatidylcholine Biosynthesis PC(15:0/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/22:0)
  • Phosphatidylcholine Biosynthesis PC(15:0/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(15:0/24:0)
  • Phosphatidylcholine Biosynthesis PC(15:0/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/14:0)
  • Phosphatidylcholine Biosynthesis PC(16:0/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/15:0)
  • Phosphatidylcholine Biosynthesis PC(16:0/16:0)
  • Phosphatidylcholine Biosynthesis PC(16:0/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/18:0)
  • Phosphatidylcholine Biosynthesis PC(16:0/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/20:0)
  • Phosphatidylcholine Biosynthesis PC(16:0/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/22:0)
  • Phosphatidylcholine Biosynthesis PC(16:0/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(16:0/24:0)
  • Phosphatidylcholine Biosynthesis PC(16:0/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/14:0)
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/15:0)
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/16:0)
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/18:0)
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(16:1(9Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/14:0)
  • Phosphatidylcholine Biosynthesis PC(18:0/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/15:0)
  • Phosphatidylcholine Biosynthesis PC(18:0/16:0)
  • Phosphatidylcholine Biosynthesis PC(18:0/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/18:0)
  • Phosphatidylcholine Biosynthesis PC(18:0/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/20:0)
  • Phosphatidylcholine Biosynthesis PC(18:0/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/22:0)
  • Phosphatidylcholine Biosynthesis PC(18:0/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(18:0/24:0)
  • Phosphatidylcholine Biosynthesis PC(18:0/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/14:0)
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/15:0)
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/16:0)
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/18:0)
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(18:1(11Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/14:0)
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/15:0)
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/16:0)
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/18:0)
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(18:1(9Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/14:0)
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/15:0)
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/16:0)
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/18:0)
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(18:2(9Z,12Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/14:0)
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/15:0)
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/16:0)
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/18:0)
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(18:3(6Z,9Z,12Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/14:0)
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/15:0)
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/16:0)
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/18:0)
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(18:3(9Z,12Z,15Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/14:0)
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/15:0)
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/16:0)
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/18:0)
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(18:4(6Z,9Z,12Z,15Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/14:0)
  • Phosphatidylcholine Biosynthesis PC(20:0/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/15:0)
  • Phosphatidylcholine Biosynthesis PC(20:0/16:0)
  • Phosphatidylcholine Biosynthesis PC(20:0/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/18:0)
  • Phosphatidylcholine Biosynthesis PC(20:0/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/20:0)
  • Phosphatidylcholine Biosynthesis PC(20:0/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/22:0)
  • Phosphatidylcholine Biosynthesis PC(20:0/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(20:0/24:0)
  • Phosphatidylcholine Biosynthesis PC(20:0/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/14:0)
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/15:0)
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/16:0)
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/18:0)
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(20:1(11Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/14:0)
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/15:0)
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/16:0)
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/18:0)
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(20:2(11Z,14Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/14:0)
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/15:0)
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/16:0)
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/18:0)
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(20:3(5Z,8Z,11Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/14:0)
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/15:0)
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/16:0)
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/18:0)
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(20:3(8Z,11Z,14Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/14:0)
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/15:0)
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/16:0)
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/18:0)
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(20:4(5Z,8Z,11Z,14Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/14:0)
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/15:0)
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/16:0)
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/18:0)
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(20:4(8Z,11Z,14Z,17Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/14:0)
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/15:0)
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/16:0)
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/18:0)
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(20:5(5Z,8Z,11Z,14Z,17Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/14:0)
  • Phosphatidylcholine Biosynthesis PC(22:0/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/15:0)
  • Phosphatidylcholine Biosynthesis PC(22:0/16:0)
  • Phosphatidylcholine Biosynthesis PC(22:0/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/18:0)
  • Phosphatidylcholine Biosynthesis PC(22:0/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/20:0)
  • Phosphatidylcholine Biosynthesis PC(22:0/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/22:0)
  • Phosphatidylcholine Biosynthesis PC(22:0/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(22:0/24:0)
  • Phosphatidylcholine Biosynthesis PC(22:0/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/14:0)
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/15:0)
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/16:0)
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/18:0)
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(22:1(13Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/14:0)
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/15:0)
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/16:0)
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/18:0)
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(22:2(13Z,16Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/14:0)
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/15:0)
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/16:0)
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/18:0)
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(22:4(7Z,10Z,13Z,16Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/14:0)
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/15:0)
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/16:0)
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/18:0)
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(22:5(4Z,7Z,10Z,13Z,16Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/14:0)
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/15:0)
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/16:0)
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/18:0)
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(22:5(7Z,10Z,13Z,16Z,19Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/14:0)
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/15:0)
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:0)
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:0)
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(22:6(4Z,7Z,10Z,13Z,16Z,19Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(24:0/14:0)
  • Phosphatidylcholine Biosynthesis PC(24:0/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(24:0/15:0)
  • Phosphatidylcholine Biosynthesis PC(24:0/16:0)
  • Phosphatidylcholine Biosynthesis PC(24:0/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(24:0/18:0)
  • Phosphatidylcholine Biosynthesis PC(24:0/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(24:0/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(24:0/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(24:0/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(24:0/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(24:0/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(24:0/20:0)
  • Phosphatidylcholine Biosynthesis PC(24:0/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(24:0/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(24:0/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(24:0/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(24:0/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(24:0/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(24:0/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(24:0/22:0)
  • Phosphatidylcholine Biosynthesis PC(24:0/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(24:0/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(24:0/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(24:0/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(24:0/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(24:0/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(24:0/24:0)
  • Phosphatidylcholine Biosynthesis PC(24:0/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/14:0)
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/14:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/15:0)
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/16:0)
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/16:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/18:0)
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/18:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/18:1(9Z))
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/18:2(9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/18:3(6Z,9Z,12Z))
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/18:3(9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/18:4(6Z,9Z,12Z,15Z))
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/20:0)
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/20:1(11Z))
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/20:2(11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/20:3(5Z,8Z,11Z))
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/20:3(8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/20:4(5Z,8Z,11Z,14Z))
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/20:4(8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/20:5(5Z,8Z,11Z,14Z,17Z))
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/22:0)
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/22:1(13Z))
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/22:2(13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/22:4(7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/22:5(4Z,7Z,10Z,13Z,16Z))
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/22:5(7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/22:6(4Z,7Z,10Z,13Z,16Z,19Z))
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/24:0)
  • Phosphatidylcholine Biosynthesis PC(24:1(15Z)/24:1(15Z))
  • Phosphatidylcholine Biosynthesis PC(9D3/11D3)
  • Phosphatidylcholine Biosynthesis PC(9D3/11D5)
  • Phosphatidylcholine Biosynthesis PC(9D3/11M3)
  • Phosphatidylcholine Biosynthesis PC(9D3/11M5)
  • Phosphatidylcholine Biosynthesis PC(9D3/13D5)
  • Phosphatidylcholine Biosynthesis PC(9D3/13M5)
  • Phosphatidylcholine Biosynthesis PC(9D3/9D3)
  • Phosphatidylcholine Biosynthesis PC(9D3/9D5)
  • Phosphatidylcholine Biosynthesis PC(9D3/9M5)
  • Phosphatidylcholine Biosynthesis PC(9D5/11D3)
  • Phosphatidylcholine Biosynthesis PC(9D5/11D5)
  • Phosphatidylcholine Biosynthesis PC(9D5/11M3)
  • Phosphatidylcholine Biosynthesis PC(9D5/11M5)
  • Phosphatidylcholine Biosynthesis PC(9D5/13D5)
  • Phosphatidylcholine Biosynthesis PC(9D5/13M5)
  • Phosphatidylcholine Biosynthesis PC(9D5/9D3)
  • Phosphatidylcholine Biosynthesis PC(9D5/9D5)
  • Phosphatidylcholine Biosynthesis PC(9D5/9M5)
  • Phosphatidylcholine Biosynthesis PC(9M5/11D3)
  • Phosphatidylcholine Biosynthesis PC(9M5/11D5)
  • Phosphatidylcholine Biosynthesis PC(9M5/11M3)
  • Phosphatidylcholine Biosynthesis PC(9M5/11M5)
  • Phosphatidylcholine Biosynthesis PC(9M5/13D5)
  • Phosphatidylcholine Biosynthesis PC(9M5/13M5)
  • Phosphatidylcholine Biosynthesis PC(9M5/9D3)
  • Phosphatidylcholine Biosynthesis PC(9M5/9D5)
  • Phosphatidylcholine Biosynthesis PC(9M5/9M5)
  • Phospholipid Biosynthesis
Reactions
Cytidine triphosphate + Phosphorylcholine → Pyrophosphate + Citicoline details
Cytidine triphosphate + Phosphorylcholine → Pyrophosphate + CMP-N-trimethyl-2-aminoethylphosphonate details
GO Classification
Biological Process
response to abiotic stimulus
Cellular Component
endoplasmic reticulum membrane
cytosol
glycogen granule
Function
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
nucleotidyltransferase activity
Molecular Function
lipid binding
choline-phosphate cytidylyltransferase activity
Process
metabolic process
biosynthetic process
Cellular Location
  1. Cytoplasm
  2. Peripheral membrane protein
  3. Membrane
  4. cytosol
Gene Properties
Chromosome Location 3
Locus 3q29
SNPs PCYT1A
Gene Sequence
>1104 bp
ATGGATGCACAGTGTTCAGCCAAGGTCAATGCAAGGAAGAGGAGAAAAGAGGCGCCCGGA
CCCAACGGGGCAACAGAAGAAGATGGGGTTCCTTCCAAAGTGCAGCGCTGTGCAGTGGGC
TTACGGCAACCAGCTCCTTTTTCTGATGAAATTGAAGTTGACTTTAGTAAGCCCTATGTC
AGGGTAACTATGGAAGAAGCCAGCAGAGGAACTCCTTGTGAGCGACCTGTGAGAGTTTAT
GCCGATGGAATATTTGACTTATTTCACTCTGGTCACGCCCGAGCTCTGATGCAAGCGAAG
AACCTTTTCCCTAATACGTACCTCATTGTGGGAGTTTGCAGTGATGAGCTCACACACAAC
TTCAAAGGCTTCACGGTGATGAACGAGAATGAGCGCTATGACGCAGTCCAGCACTGCCGC
TACGTGGATGAGGTGGTGAGGAATGCGCCCTGGACGCTGACACCCGAGTTCCTGGCCGAA
CACCGGATTGATTTTGTAGCCCATGATGATATTCCTTATTCATCTGCTGGCAGTGATGAT
GTTTATAAGCACATCAAGGAGGCAGGCATGTTTGCTCCAACACAGAGGACAGAAGGTATC
TCCACATCAGACATCATCACCCGAATTGTGCGGGATTATGATGTGTATGCGAGGCGGAAC
CTGCAGAGGGGCTACACAGCAAAGGAGCTCAATGTCAGCTTTATCAACGAGAAGAAATAC
CACTTGCAGGAGAGGGTTGACAAAGTAAAGAAGAAAGTGAAAGATGTGGAGGAAAAGTCA
AAAGAATTTGTTCAGAAGGTGGAGGAAAAAAGCATTGACCTCATTCAGAAGTGGGAGGAG
AAGTCCCGAGAATTCATTGGAAGTTTTCTGGAAATGTTTGGTCCGGAAGGAGCACTGAAA
CATATGCTGAAAGAGGGGAAGGGCCGGATGCTGCAGGCCATCAGCCCGAAGCAGAGCCCC
AGCAGCAGCCCTACTCGCGAGCGCTCCCCCTCCCCCTCTTTCCGATGGCCCTTCTCCGGC
AAGACTTCCCCACCTTGCTCCCCAGCAAATCTCTCCAGGCACAAGGCTGCAGCCTATGAT
ATCAGTGAGGATGAAGAAGACTAA
Protein Properties
Number of Residues 367
Molecular Weight 41730.67
Theoretical pI 7.261
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Choline-phosphate cytidylyltransferase A
MDAQCSAKVNARKRRKEAPGPNGATEEDGVPSKVQRCAVGLRQPAPFSDEIEVDFSKPYV
RVTMEEASRGTPCERPVRVYADGIFDLFHSGHARALMQAKNLFPNTYLIVGVCSDELTHN
FKGFTVMNENERYDAVQHCRYVDEVVRNAPWTLTPEFLAEHRIDFVAHDDIPYSSAGSDD
VYKHIKEAGMFAPTQRTEGISTSDIITRIVRDYDVYARRNLQRGYTAKELNVSFINEKKY
HLQERVDKVKKKVKDVEEKSKEFVQKVEEKSIDLIQKWEEKSREFIGSFLEMFGPEGALK
HMLKEGKGRMLQAISPKQSPSSSPTRERSPSPSFRWPFSGKTSPPCSPANLSRHKAAAYD
ISEDEED
GenBank ID Protein 28204946
UniProtKB/Swiss-Prot ID P49585
UniProtKB/Swiss-Prot Entry Name PCY1A_HUMAN
PDB IDs Not Available
GenBank Gene ID BC046355
GeneCard ID PCYT1A
GenAtlas ID PCYT1A
HGNC ID HGNC:8754
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. [PubMed:19608861 ]
  3. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  4. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  5. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. [PubMed:18691976 ]
  6. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  7. Imami K, Sugiyama N, Kyono Y, Tomita M, Ishihama Y: Automated phosphoproteome analysis for cultured cancer cells by two-dimensional nanoLC-MS using a calcined titania/C18 biphasic column. Anal Sci. 2008 Jan;24(1):161-6. [PubMed:18187866 ]
  8. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  9. Beausoleil SA, Villen J, Gerber SA, Rush J, Gygi SP: A probability-based approach for high-throughput protein phosphorylation analysis and site localization. Nat Biotechnol. 2006 Oct;24(10):1285-92. Epub 2006 Sep 10. [PubMed:16964243 ]
  10. Giorgianni F, Zhao Y, Desiderio DM, Beranova-Giorgianni S: Toward a global characterization of the phosphoproteome in prostate cancer cells: identification of phosphoproteins in the LNCaP cell line. Electrophoresis. 2007 Jun;28(12):2027-34. [PubMed:17487921 ]
  11. Kalmar GB, Kay RJ, LaChance AC, Cornell RB: Primary structure and expression of a human CTP:phosphocholine cytidylyltransferase. Biochim Biophys Acta. 1994 Oct 18;1219(2):328-34. [PubMed:7918629 ]
  12. Johnson JE, Cornell RB: Membrane-binding amphipathic alpha-helical peptide derived from CTP:phosphocholine cytidylyltransferase. Biochemistry. 1994 Apr 12;33(14):4327-35. [PubMed:8155650 ]
  13. Dunne SJ, Cornell RB, Johnson JE, Glover NR, Tracey AS: Structure of the membrane binding domain of CTP:phosphocholine cytidylyltransferase. Biochemistry. 1996 Sep 17;35(37):11975-84. [PubMed:8810902 ]
  14. Xie M, Smith JL, Ding Z, Zhang D, Cornell RB: Membrane binding modulates the quaternary structure of CTP:phosphocholine cytidylyltransferase. J Biol Chem. 2004 Jul 2;279(27):28817-25. Epub 2004 Apr 6. [PubMed:15069071 ]