You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP00768
Secondary Accession Numbers
  • 6045
Name N(G),N(G)-dimethylarginine dimethylaminohydrolase 2
Synonyms
  1. DDAH-2
  2. DDAHII
  3. Dimethylargininase-2
  4. Dimethylarginine dimethylaminohydrolase 2
  5. Protein G6a
  6. S-phase protein
Gene Name DDAH2
Protein Type Enzyme
Biological Properties
General Function Involved in hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amidines
Specific Function Hydrolyzes N(G),N(G)-dimethyl-L-arginine (ADMA) and N(G)-monomethyl-L-arginine (MMA) which act as inhibitors of NOS. Has therefore a role in the regulation of nitric oxide generation.
Pathways Not Available
Reactions
Asymmetric dimethylarginine + Water → Dimethylamine + Citrulline details
GO Classification
Biological Process
negative regulation of apoptotic process
citrulline metabolic process
nitric oxide mediated signal transduction
positive regulation of nitric oxide biosynthetic process
arginine catabolic process
nitric oxide biosynthetic process
Cellular Component
mitochondrion
Component
cell part
intracellular part
cytoplasm
Function
catalytic activity
hydrolase activity
hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amidines
hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds
Molecular Function
dimethylargininase activity
amino acid binding
Cellular Location
  1. Cytoplasmic
Gene Properties
Chromosome Location 6
Locus 6p21.3
SNPs DDAH2
Gene Sequence
>858 bp
ATGGGGACGCCGGGGGAGGGGCTGGGCCGCTGCTCCCATGCCCTGATCCGGGGAGTCCCA
GAGAGCCTGGCGTCGGGGGAAGGTGCGGGGGCTGGCCTTCCCGCTCTGGATCTGGCCAAA
GCTCAAAGGGAGCACGGGGTGCTGGGAGGTAAACTGAGGCAACGACTGGGGCTACAGCTG
CTAGAACTGCCACCTGAGGAGTCATTGCCGCTGGGACCGCTGCTTGGCGACACGGCCGTG
ATCCAAGGGGACACGGCCCTAATCACGCGGCCCTGGAGCCCCGCTCGTAGGCCAGAGGTC
GATGGAGTCCGCAAAGCCCTGCAAGACCTGGGGCTCCGAATTGTGGAAATAGGAGACGAG
AACGCGACGCTGGATGGCACTGACGTTCTCTTCACCGGCCGGGAGTTTTTCGTAGGCCTC
TCCAAATGGACCAATCACCGAGGAGCTGAGATCGTGGCGGACACGTTCCGGGACTTCGCC
GTCTCCACTGTGCCAGTCTCGGGTCCCTCCCACCTGCGCGGTCTCTGCGGCATGGGGGGA
CCTCGCACTGTTGTGGCAGGCAGCAGCGACGCTGCCCAAAAGGCTGTCCGGGCAATGGCA
GTGCTGACAGATCACCCATATGCCTCCCTGACCCTCCCAGATGACGCAGCTGCTGACTGC
CTCTTTCTTCGTCCTGGGTTGCCTGGTGTGCCCCCTTTCCTCCTGCACCGTGGAGGTGGG
GATCTGCCCAACAGCCAGGAGGCACTGCAGAAGCTCTCTGATGTCACCCTGGTACCTGTG
TCCTGCTCAGAACTGGAGAAGGCTGGCGCCGGGCTCAGCTCCCTCTGCTTGGTGCTCAGC
ACACGCCCCCACAGCTGA
Protein Properties
Number of Residues 285
Molecular Weight 29643.54
Theoretical pI 6.016
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>N(G),N(G)-dimethylarginine dimethylaminohydrolase 2
MGTPGEGLGRCSHALIRGVPESLASGEGAGAGLPALDLAKAQREHGVLGGKLRQRLGLQL
LELPPEESLPLGPLLGDTAVIQGDTALITRPWSPARRPEVDGVRKALQDLGLRIVEIGDE
NATLDGTDVLFTGREFFVGLSKWTNHRGAEIVADTFRDFAVSTVPVSGPSHLRGLCGMGG
PRTVVAGSSDAAQKAVRAMAVLTDHPYASLTLPDDAAADCLFLRPGLPGVPPFLLHRGGG
DLPNSQEALQKLSDVTLVPVSCSELEKAGAGLSSLCLVLSTRPHS
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID O95865
UniProtKB/Swiss-Prot Entry Name DDAH2_HUMAN
PDB IDs Not Available
GenBank Gene ID AF070667
GeneCard ID DDAH2
GenAtlas ID DDAH2
HGNC ID HGNC:2716
References
General References
  1. Mungall AJ, Palmer SA, Sims SK, Edwards CA, Ashurst JL, Wilming L, Jones MC, Horton R, Hunt SE, Scott CE, Gilbert JG, Clamp ME, Bethel G, Milne S, Ainscough R, Almeida JP, Ambrose KD, Andrews TD, Ashwell RI, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beare DM, Beasley H, Beasley O, Bird CP, Blakey S, Bray-Allen S, Brook J, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Clark SY, Clark G, Clee CM, Clegg S, Cobley V, Collier RE, Collins JE, Colman LK, Corby NR, Coville GJ, Culley KM, Dhami P, Davies J, Dunn M, Earthrowl ME, Ellington AE, Evans KA, Faulkner L, Francis MD, Frankish A, Frankland J, French L, Garner P, Garnett J, Ghori MJ, Gilby LM, Gillson CJ, Glithero RJ, Grafham DV, Grant M, Gribble S, Griffiths C, Griffiths M, Hall R, Halls KS, Hammond S, Harley JL, Hart EA, Heath PD, Heathcott R, Holmes SJ, Howden PJ, Howe KL, Howell GR, Huckle E, Humphray SJ, Humphries MD, Hunt AR, Johnson CM, Joy AA, Kay M, Keenan SJ, Kimberley AM, King A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd CR, Lloyd DM, Loveland JE, Lovell J, Martin S, Mashreghi-Mohammadi M, Maslen GL, Matthews L, McCann OT, McLaren SJ, McLay K, McMurray A, Moore MJ, Mullikin JC, Niblett D, Nickerson T, Novik KL, Oliver K, Overton-Larty EK, Parker A, Patel R, Pearce AV, Peck AI, Phillimore B, Phillips S, Plumb RW, Porter KM, Ramsey Y, Ranby SA, Rice CM, Ross MT, Searle SM, Sehra HK, Sheridan E, Skuce CD, Smith S, Smith M, Spraggon L, Squares SL, Steward CA, Sycamore N, Tamlyn-Hall G, Tester J, Theaker AJ, Thomas DW, Thorpe A, Tracey A, Tromans A, Tubby B, Wall M, Wallis JM, West AP, White SS, Whitehead SL, Whittaker H, Wild A, Willey DJ, Wilmer TE, Wood JM, Wray PW, Wyatt JC, Young L, Younger RM, Bentley DR, Coulson A, Durbin R, Hubbard T, Sulston JE, Dunham I, Rogers J, Beck S: The DNA sequence and analysis of human chromosome 6. Nature. 2003 Oct 23;425(6960):805-11. [PubMed:14574404 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Zhang QH, Ye M, Wu XY, Ren SX, Zhao M, Zhao CJ, Fu G, Shen Y, Fan HY, Lu G, Zhong M, Xu XR, Han ZG, Zhang JW, Tao J, Huang QH, Zhou J, Hu GX, Gu J, Chen SJ, Chen Z: Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells. Genome Res. 2000 Oct;10(10):1546-60. [PubMed:11042152 ]
  4. Xie T, Rowen L, Aguado B, Ahearn ME, Madan A, Qin S, Campbell RD, Hood L: Analysis of the gene-dense major histocompatibility complex class III region and its comparison to mouse. Genome Res. 2003 Dec;13(12):2621-36. [PubMed:14656967 ]
  5. Leiper JM, Santa Maria J, Chubb A, MacAllister RJ, Charles IG, Whitley GS, Vallance P: Identification of two human dimethylarginine dimethylaminohydrolases with distinct tissue distributions and homology with microbial arginine deiminases. Biochem J. 1999 Oct 1;343 Pt 1:209-14. [PubMed:10493931 ]
  6. Ribas G, Neville M, Wixon JL, Cheng J, Campbell RD: Genes encoding three new members of the leukocyte antigen 6 superfamily and a novel member of Ig superfamily, together with genes encoding the regulatory nuclear chloride ion channel protein (hRNCC) and an N omega-N omega-dimethylarginine dimethylaminohydrolase homologue, are found in a 30-kb segment of the MHC class III region. J Immunol. 1999 Jul 1;163(1):278-87. [PubMed:10384126 ]