You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP00781
Secondary Accession Numbers
  • 6061
Name 3-mercaptopyruvate sulfurtransferase
Synonyms
  1. MST
Gene Name MPST
Protein Type Enzyme
Biological Properties
General Function Involved in thiosulfate sulfurtransferase activity
Specific Function Transfer of a sulfur ion to cyanide or to other thiol compounds. Also has weak rhodanese activity. May have a role in cyanide degradation or in thiosulfate biosynthesis.
Pathways
  • Beta-mercaptolactate-cysteine disulfiduria
  • Cysteine and methionine metabolism
  • Cysteine Metabolism
  • Cystinosis, ocular nonnephropathic
  • Sulfur relay system
Reactions
3-Mercaptopyruvic acid + Hydrogen cyanide → Pyruvic acid + Thiocyanate details
Thiosulfate + Hydrogen cyanide → Sulfurous acid + Thiocyanate details
3-Mercaptopyruvic acid + Sulfurous acid → Thiosulfate + Pyruvic acid details
GO Classification
Biological Process
response to toxin
cyanate catabolic process
Cellular Component
mitochondrion
mitochondrial inner membrane
Function
catalytic activity
transferase activity
transferase activity, transferring sulfur-containing groups
sulfurtransferase activity
thiosulfate sulfurtransferase activity
Molecular Function
thiosulfate sulfurtransferase activity
3-mercaptopyruvate sulfurtransferase activity
Process
establishment of localization
transport
anion transport
inorganic anion transport
sulfate transport
ion transport
Cellular Location
  1. Cytoplasm
Gene Properties
Chromosome Location 22
Locus 22q13.1
SNPs MPST
Gene Sequence
>894 bp
ATGGCTTCGCCGCAGCTCTGCCGCGCGCTGGTGTCGGCGCAATGGGTGGCGGAGGCGCTG
CGGGCCCCGCGCGCTGGGCAGCCTCTGCAGCTGCTGGACGCCTCCTGGTACCTGCCGAAG
CTGGGGCGCGACGCGCGACGCGAGTTCGAGGAGCGCCACATCCCGGGCGCCGCTTTCTTC
GACATCGACCAGTGCAGCGACCGCACCTCGCCCTACGACCACATGCTGCCCGGGGCCGAG
CATTTCGCGGAGTACGCAGGCCGCCTGGGCGTGGGCGCGGCCACCCACGTCGTGATCTAC
GACGCCAGCGACCAGGGCCTCTACTCCGCCCCGCGCGTCTGGTGGATGTTCCGCGCCTTC
GGCCACCACGCCGTGTCACTGCTTGATGGCGGCCTCCGCCACTGGCTGCGCCAGAACCTC
CCGCTCAGCTCCGGCAAGAGCCAACCTGCTCCCGCCGAGTTCCGCGCTCAGCTCGACCCC
GCCTTCATCAAGACCTACGAGGACATCAAGGAGAACCTGGAATCCCGGCGCTTCCAGGTG
GTGGACTCCCGAGCCACTGGCAGGTTCCGCGGCACCGAGCCCGAGCCCCGAGACGGCATT
GAACCTGGCCACATCCCAGGTACCGTGAACATCCCCTTCACAGACTTCCTGAGCCAGGAG
GGGCTGGAGAAGAGCCCTGAGGAGATCCGCCATCTGTTCCAGGAGAAGAAAGTGGACCTG
TCTAAGCCACTGGTGGCCACGTGTGGCTCTGGCGTCACAGCCTGCCACGTGGCACTAGGG
GCCTACCTCTGCGGCAAGCCAGACGTGCCCATCTACGATGGCTCCTGGGTGGAGTGGTAC
ATGCGCGCCCGGCCCGAGGATGTCATCTCAGAGGGCCGGGGGAAGACCCACTGA
Protein Properties
Number of Residues 297
Molecular Weight 33178.15
Theoretical pI 6.601
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>3-mercaptopyruvate sulfurtransferase
MASPQLCRALVSAQWVAEALRAPRAGQPLQLLDASWYLPKLGRDARREFEERHIPGAAFF
DIDQCSDRTSPYDHMLPGAEHFAEYAGRLGVGAATHVVIYDASDQGLYSAPRVWWMFRAF
GHHAVSLLDGGLRHWLRQNLPLSSGKSQPAPAEFRAQLDPAFIKTYEDIKENLESRRFQV
VDSRATGRFRGTEPEPRDGIEPGHIPGTVNIPFTDFLSQEGLEKSPEEIRHLFQEKKVDL
SKPLVATCGSGVTACHVALGAYLCGKPDVPIYDGSWVEWYMRARPEDVISEGRGKTH
GenBank ID Protein 13097573
UniProtKB/Swiss-Prot ID P25325
UniProtKB/Swiss-Prot Entry Name THTM_HUMAN
PDB IDs
GenBank Gene ID BC003508
GeneCard ID MPST
GenAtlas ID MPST
HGNC ID HGNC:7223
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Dunham I, Shimizu N, Roe BA, Chissoe S, Hunt AR, Collins JE, Bruskiewich R, Beare DM, Clamp M, Smink LJ, Ainscough R, Almeida JP, Babbage A, Bagguley C, Bailey J, Barlow K, Bates KN, Beasley O, Bird CP, Blakey S, Bridgeman AM, Buck D, Burgess J, Burrill WD, O'Brien KP, et al.: The DNA sequence of human chromosome 22. Nature. 1999 Dec 2;402(6761):489-95. [PubMed:10591208 ]
  3. Collins JE, Wright CL, Edwards CA, Davis MP, Grinham JA, Cole CG, Goward ME, Aguado B, Mallya M, Mokrab Y, Huckle EJ, Beare DM, Dunham I: A genome annotation-driven approach to cloning the human ORFeome. Genome Biol. 2004;5(10):R84. Epub 2004 Sep 30. [PubMed:15461802 ]
  4. Pallini R, Guazzi GC, Cannella C, Cacace MG: Cloning and sequence analysis of the human liver rhodanese: comparison with the bovine and chicken enzymes. Biochem Biophys Res Commun. 1991 Oct 31;180(2):887-93. [PubMed:1953758 ]