You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP00796
Secondary Accession Numbers
  • 6076
Name 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3
Synonyms
  1. 6-phosphofructo-2-kinase
  2. 6PF-2-K/Fru-2,6-P2ase 3
  3. 6PF-2-K/Fru-2,6-P2ase brain/placenta-type isozyme
  4. Fructose-2,6-bisphosphatase
  5. PFK/FBPase 3
  6. Renal carcinoma antigen NY-REN-56
  7. iPFK-2
Gene Name PFKFB3
Protein Type Enzyme
Biological Properties
General Function Involved in catalytic activity
Specific Function Synthesis and degradation of fructose 2,6-bisphosphate.
Pathways
  • Fructose and mannose metabolism
  • HIF-1 signaling pathway
Reactions
D-Fructose 2,6-bisphosphate + Water → Fructose 6-phosphate + Phosphoric acid details
Adenosine triphosphate + Fructose 6-phosphate → ADP + D-Fructose 2,6-bisphosphate details
D-Fructose 2,6-bisphosphate + Water → Beta-D-Fructose 6-phosphate + Phosphoric acid details
GO Classification
Biological Process
small molecule metabolic process
fructose metabolic process
glycolysis
fructose 2,6-bisphosphate metabolic process
Cellular Component
cytosol
Function
binding
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
phosphotransferase activity, alcohol group as acceptor
phosphofructokinase activity
6-phosphofructo-2-kinase activity
Molecular Function
ATP binding
fructose-2,6-bisphosphate 2-phosphatase activity
6-phosphofructo-2-kinase activity
Process
metabolic process
small molecule metabolic process
alcohol metabolic process
monosaccharide metabolic process
hexose metabolic process
fructose metabolic process
fructose 2,6-bisphosphate metabolic process
Cellular Location Not Available
Gene Properties
Chromosome Location 10
Locus 10p15.1
SNPs PFKFB3
Gene Sequence
>1563 bp
ATGCCGTTGGAACTGACGCAGAGCCGAGTGCAGAAGATCTGGGTGCCCGTGGACCACAGG
CCCTCGTTGCCCAGATCCTGTGGGCCAAAGCTGACCAACTCCCCCACCGTCATCGTCATG
GTGGGCCTCCCCGCCCGGGGCAAGACCTACATCTCCAAGAAGCTGACTCGCTACCTCAAC
TGGATTGGCGTCCCCACAAAAGTGTTCAACGTCGGGGAGTATCGCCGGGAGGCTGTGAAG
CAGTACAGCTCCTACAACTTCTTCCGCCCCGACAATGAGGAAGCCATGAAAGTCCGGAAG
CAATGTGCCTTAGCTGCCTTGAGAGATGTCAAAAGCTACCTGGCGAAAGAAGGGGGACAA
ATTGCGGTTTTCGATGCCACCAATACTACTAGAGAGAGGAGACATGTGATCCTTCATTTT
GCCAAAGAAAATGACTTTAAGGCGTTTTTCATCGAGTCGGTGTGCGACGACCCTACAGTT
GTGGCCTCCAATATCATGGAAGTTAAAATCTCCAGCCCGGATTACAAAGACTGCAACTCG
GCAGAAGCCATGGACGACTTCATGAAGAGGATCAGTTGCTATGAAGCCAGCTACCAGCCC
CTCGACCCCGACAAATGCGACAGGGACTTGTCGCTGATCAAGGTGATTGACGTGGGCCGG
AGGTTCCTGGTGAACCGGGTGCAGGACCACATCCAGAGCCGCATCGTGTACTACCTGATG
AACATCCACGTGCAGCCGCGTACCATCTACCTGTGCCGGCACGGCGAGAACGAGCACAAC
CTCCAGGGCCGCATCGGGGGCGACTCAGGCCTGTCCAGCCGGGGCAAGAAGTTTGCCAGT
GCTCTGAGCAAGTTCGTGGAGGAGCAGAACCTGAAGGACCTGCGCGTGTGGACCAGCCAG
CTGAAGAGCACCATCCAGACGGCCGAGGCGCTGCGGCTGCCCTACGAGCAGTGGAAGGCG
CTCAATGAGATCGACGCGGGCGTCTGTGAGGAGCTGACCTACGAGGAGATCAGGGACACC
TACCCTGAGGAGTATGCGCTGCGGGAGCAGGACAAGTACTATTACCGCTACCCCACCGGG
GAGTCCTACCAGGACCTGGTCCAGCGCTTGGAGCCAGTGATCATGGAGCTGGAGCGGCAG
GAGAATGTGCTGGTCATCTGCCACCAGGCCGTCCTGCGCTGCCTGCTTGCCTACTTCCTG
GATAAGAGTGCAGAGGAGATGCCCTACCTGAAATGCCCTCTTCACACCGTCCTGAAACTG
ACGCCTGTCGCTTATGGCTGCCGTGTGGAATCCATCTACCTGAACGTGGAGTCCGTCTGC
ACACACCGGGAGAGGTCAGAGGATGCAAAGAAGGGACCTAACCCGCTCATGAGACGCAAT
AGTGTCACCCCGCTAGCCAGCCCCGAACCCACCAAAAAGCCTCGCATCAACAGCTTTGAG
GAGCATGTGGCCTCCACCTCGGCCGCCCTGCCCAGCTGCCTGCCCCCGGAGGTGCCCACG
CAGCTGCCTGGACAAAACATGAAAGGCTCCCGGAGCAGCGCTGACTCCTCCAGGAAACAC
TGA
Protein Properties
Number of Residues 520
Molecular Weight 57286.965
Theoretical pI 8.201
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 3
MPLELTQSRVQKIWVPVDHRPSLPRSCGPKLTNSPTVIVMVGLPARGKTYISKKLTRYLN
WIGVPTKVFNVGEYRREAVKQYSSYNFFRPDNEEAMKVRKQCALAALRDVKSYLAKEGGQ
IAVFDATNTTRERRHMILHFAKENDFKAFFIESVCDDPTVVASNIMEVKISSPDYKDCNS
AEAMDDFMKRISCYEASYQPLDPDKCDRDLSLIKVIDVGRRFLVNRVQDHIQSRIVYYLM
NIHVQPRTIYLCRHGENEHNLQGRIGGDSGLSSRGKKFASALSKFVEEQNLKDLRVWTSQ
LKSTIQTAEALRLPYEQWKALNEIDAGVCEELTYEEIRDTYPEEYALREQDKYYYRYPTG
ESYQDLVQRLEPVIMELERQENVLVICHQAVLRCLLAYFLDKSAEEMPYLKCPLHTVLKL
TPVAYGCRVESIYLNVESVCTHRERSEDAKKGPNPLMRRNSVTPLASPEPTKKPRINSFE
EHVASTSAALPSCLPPEVPTQLPGQNMKGSRSSADSSRKH
GenBank ID Protein 2827312
UniProtKB/Swiss-Prot ID Q16875
UniProtKB/Swiss-Prot Entry Name F263_HUMAN
PDB IDs
GenBank Gene ID AF041831
GeneCard ID PFKFB3
GenAtlas ID PFKFB3
HGNC ID HGNC:8874
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  3. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  4. Deloukas P, Earthrowl ME, Grafham DV, Rubenfield M, French L, Steward CA, Sims SK, Jones MC, Searle S, Scott C, Howe K, Hunt SE, Andrews TD, Gilbert JG, Swarbreck D, Ashurst JL, Taylor A, Battles J, Bird CP, Ainscough R, Almeida JP, Ashwell RI, Ambrose KD, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Bates K, Beasley H, Bray-Allen S, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Cahill P, Camire D, Carter NP, Chapman JC, Clark SY, Clarke G, Clee CM, Clegg S, Corby N, Coulson A, Dhami P, Dutta I, Dunn M, Faulkner L, Frankish A, Frankland JA, Garner P, Garnett J, Gribble S, Griffiths C, Grocock R, Gustafson E, Hammond S, Harley JL, Hart E, Heath PD, Ho TP, Hopkins B, Horne J, Howden PJ, Huckle E, Hynds C, Johnson C, Johnson D, Kana A, Kay M, Kimberley AM, Kershaw JK, Kokkinaki M, Laird GK, Lawlor S, Lee HM, Leongamornlert DA, Laird G, Lloyd C, Lloyd DM, Loveland J, Lovell J, McLaren S, McLay KE, McMurray A, Mashreghi-Mohammadi M, Matthews L, Milne S, Nickerson T, Nguyen M, Overton-Larty E, Palmer SA, Pearce AV, Peck AI, Pelan S, Phillimore B, Porter K, Rice CM, Rogosin A, Ross MT, Sarafidou T, Sehra HK, Shownkeen R, Skuce CD, Smith M, Standring L, Sycamore N, Tester J, Thorpe A, Torcasso W, Tracey A, Tromans A, Tsolas J, Wall M, Walsh J, Wang H, Weinstock K, West AP, Willey DL, Whitehead SL, Wilming L, Wray PW, Young L, Chen Y, Lovering RC, Moschonas NK, Siebert R, Fechtel K, Bentley D, Durbin R, Hubbard T, Doucette-Stamm L, Beck S, Smith DR, Rogers J: The DNA sequence and comparative analysis of human chromosome 10. Nature. 2004 May 27;429(6990):375-81. [PubMed:15164054 ]
  5. Scanlan MJ, Gordan JD, Williamson B, Stockert E, Bander NH, Jongeneel V, Gure AO, Jager D, Jager E, Knuth A, Chen YT, Old LJ: Antigens recognized by autologous antibody in patients with renal-cell carcinoma. Int J Cancer. 1999 Nov 12;83(4):456-64. [PubMed:10508479 ]
  6. Sakai A, Kato M, Fukasawa M, Ishiguro M, Furuya E, Sakakibara R: Cloning of cDNA encoding for a novel isozyme of fructose 6-phosphate, 2-kinase/fructose 2,6-bisphosphatase from human placenta. J Biochem. 1996 Mar;119(3):506-11. [PubMed:8830046 ]
  7. Manzano A, Rosa JL, Ventura F, Perez JX, Nadal M, Estivill X, Ambrosio S, Gil J, Bartrons R: Molecular cloning, expression, and chromosomal localization of a ubiquitously expressed human 6-phosphofructo-2-kinase/ fructose-2, 6-bisphosphatase gene (PFKFB3). Cytogenet Cell Genet. 1998;83(3-4):214-7. [PubMed:10072580 ]
  8. Chesney J, Mitchell R, Benigni F, Bacher M, Spiegel L, Al-Abed Y, Han JH, Metz C, Bucala R: An inducible gene product for 6-phosphofructo-2-kinase with an AU-rich instability element: role in tumor cell glycolysis and the Warburg effect. Proc Natl Acad Sci U S A. 1999 Mar 16;96(6):3047-52. [PubMed:10077634 ]