Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP00801
Secondary Accession Numbers
  • 6081
Name Fructose-1,6-bisphosphatase isozyme 2
Synonyms
  1. D-fructose-1,6-bisphosphate 1-phosphohydrolase 2
  2. FBPase 2
Gene Name FBP2
Protein Type Enzyme
Biological Properties
General Function Involved in phosphoric ester hydrolase activity
Specific Function Not Available
Pathways
  • Fructose and mannose metabolism
  • gluconeogenesis
  • Glycolysis / Gluconeogenesis
  • Insulin signaling pathway
  • Pentose phosphate pathway
Reactions
Fructose 1,6-bisphosphate + Water → Fructose 6-phosphate + Phosphoric acid details
beta-D-Fructose 1,6-bisphosphate + Water → Beta-D-Fructose 6-phosphate + Phosphoric acid details
GO Classification
Biological Process
small molecule metabolic process
fructose metabolic process
gluconeogenesis
Cellular Component
cytosol
Function
hydrolase activity, acting on ester bonds
catalytic activity
hydrolase activity
phosphoric ester hydrolase activity
Molecular Function
metal ion binding
fructose 1,6-bisphosphate 1-phosphatase activity
fructose-2,6-bisphosphate 2-phosphatase activity
Process
metabolic process
primary metabolic process
carbohydrate metabolic process
Cellular Location
  1. Cytoplasmic
Gene Properties
Chromosome Location 9
Locus 9q22.3
SNPs FBP2
Gene Sequence
>1020 bp
ATGACGGACAGAAGCCCCTTCGAAACCGACATGCTCACCCTGACCCGCTACGTTATGGAA
AAGGGGCGTCAGGCCAAAGGGACTGGGGAGCTCACCCAGCTGCTGAACTCAATGCTGACG
GCCATCAAAGCCATCTCCTCGGCTGTGCGCAAGGCCGGTCTGGCCCACCTGTATGGAATC
GCAGGAAGCGTTAACGTGACGGGAGATGAGGTGAAGAAACTGGATGTGCTATCCAATTCC
CTGGTGATCAACATGGTCCAATCCTCCTATAGTACCTGCGTCCTGGTCTCAGAAGAGAAT
AAGGACGCCATCATCACCGCCAAGGAGAAGCGGGGGAAATACGTGGTCTGCTTTGACCCA
CTGGATGGATCTTCCAATATTGACTGCCTGGCCTCCATCGGAACCATCTTTGCCATCTAT
AGAAAGACCTCAGAGGATGAGCCTTCTGAAAAGGATGCCCTGCAGTGTGGCCGCAATATT
GTGGCCGCAGGTTATGCGCTGTACGGTAGTGCAACCCTGGTGGCTCTCTCCACAGGGCAA
GGCGTGGACCTCTTCATGCTTGACCCGGCTCTTGGTGAATTTGTCCTGGTGGAAAAAGAT
GTCAAGATTAAGAAGAAAGGAAAGATTTACAGCCTGAATGAGGGCTATGCCAAGTATTTT
GATGCGGCCACCACTGAATATGTGCAGAAAAAGAAATTCCCTGAGGATGGCAGTGCTCCC
TATGGGGCCAGGTATGTGGGCTCCATGGTGGCTGACGTGCACCGCACCCTGGTCTATGGA
GGAATCTTCCTGTACCCAGCCAACCAGAAGAGCCCTAAGGGCAAGCTCCGGCTCCTGTAT
GAATGCAATCCCGTGGCCTACATCATTGAGCAGGCAGGAGGCTTGGCGACCACGGGGACC
CAGCCTGTACTGGACGTGAAGCCCGAGGCAATTCACCAGCGAGTCCCCCTCATTCTGGGG
TCACCAGAGGATGTGCAGGAATATCTCACCTGTGTGCAGAAAAATCAGGCAGGCAGCTAG
Protein Properties
Number of Residues 339
Molecular Weight 36742.84
Theoretical pI 7.23
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Fructose-1,6-bisphosphatase isozyme 2
MTDRSPFETDMLTLTRYVMEKGRQAKGTGELTQLLNSMLTAIKAISSAVRKAGLAHLYGI
AGSVNVTGDEVKKLDVLSNSLVINMVQSSYSTCVLVSEENKDAIITAKEKRGKYVVCFDP
LDGSSNIDCLASIGTIFAIYRKTSEDEPSEKDALQCGRNIVAAGYALYGSATLVALSTGQ
GVDLFMLDPALGEFVLVEKDVKIKKKGKIYSLNEGYAKYFDAATTEYVQKKKFPEDGSAP
YGARYVGSMVADVHRTLVYGGIFLYPANQKSPKGKLRLLYECNPVAYIIEQAGGLATTGT
QPVLDVKPEAIHQRVPLILGSPEDVQEYLTCVQKNQAGS
GenBank ID Protein 55662226
UniProtKB/Swiss-Prot ID O00757
UniProtKB/Swiss-Prot Entry Name F16P2_HUMAN
PDB IDs
GenBank Gene ID AL161728
GeneCard ID FBP2
GenAtlas ID FBP2
HGNC ID HGNC:3607
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Humphray SJ, Oliver K, Hunt AR, Plumb RW, Loveland JE, Howe KL, Andrews TD, Searle S, Hunt SE, Scott CE, Jones MC, Ainscough R, Almeida JP, Ambrose KD, Ashwell RI, Babbage AK, Babbage S, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beasley H, Beasley O, Bird CP, Bray-Allen S, Brown AJ, Brown JY, Burford D, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Chen Y, Clarke G, Clark SY, Clee CM, Clegg S, Collier RE, Corby N, Crosier M, Cummings AT, Davies J, Dhami P, Dunn M, Dutta I, Dyer LW, Earthrowl ME, Faulkner L, Fleming CJ, Frankish A, Frankland JA, French L, Fricker DG, Garner P, Garnett J, Ghori J, Gilbert JG, Glison C, Grafham DV, Gribble S, Griffiths C, Griffiths-Jones S, Grocock R, Guy J, Hall RE, Hammond S, Harley JL, Harrison ES, Hart EA, Heath PD, Henderson CD, Hopkins BL, Howard PJ, Howden PJ, Huckle E, Johnson C, Johnson D, Joy AA, Kay M, Keenan S, Kershaw JK, Kimberley AM, King A, Knights A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd C, Lloyd DM, Lovell J, Martin S, Mashreghi-Mohammadi M, Matthews L, McLaren S, McLay KE, McMurray A, Milne S, Nickerson T, Nisbett J, Nordsiek G, Pearce AV, Peck AI, Porter KM, Pandian R, Pelan S, Phillimore B, Povey S, Ramsey Y, Rand V, Scharfe M, Sehra HK, Shownkeen R, Sims SK, Skuce CD, Smith M, Steward CA, Swarbreck D, Sycamore N, Tester J, Thorpe A, Tracey A, Tromans A, Thomas DW, Wall M, Wallis JM, West AP, Whitehead SL, Willey DL, Williams SA, Wilming L, Wray PW, Young L, Ashurst JL, Coulson A, Blocker H, Durbin R, Sulston JE, Hubbard T, Jackson MJ, Bentley DR, Beck S, Rogers J, Dunham I: DNA sequence and analysis of human chromosome 9. Nature. 2004 May 27;429(6990):369-74. [PubMed:15164053 ]
  3. Rikova K, Guo A, Zeng Q, Possemato A, Yu J, Haack H, Nardone J, Lee K, Reeves C, Li Y, Hu Y, Tan Z, Stokes M, Sullivan L, Mitchell J, Wetzel R, Macneill J, Ren JM, Yuan J, Bakalarski CE, Villen J, Kornhauser JM, Smith B, Li D, Zhou X, Gygi SP, Gu TL, Polakiewicz RD, Rush J, Comb MJ: Global survey of phosphotyrosine signaling identifies oncogenic kinases in lung cancer. Cell. 2007 Dec 14;131(6):1190-203. [PubMed:18083107 ]
  4. Tillmann H, Eschrich K: Isolation and characterization of an allelic cDNA for human muscle fructose-1,6-bisphosphatase. Gene. 1998 Jun 8;212(2):295-304. [PubMed:9678974 ]
  5. Rakus D, Maciaszczyk E, Wawrzycka D, Ulaszewski S, Eschrich K, Dzugaj A: The origin of the high sensitivity of muscle fructose 1,6-bisphosphatase towards AMP. FEBS Lett. 2005 Oct 24;579(25):5577-81. Epub 2005 Sep 28. [PubMed:16213487 ]