You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP00804
Secondary Accession Numbers
  • 6084
Name 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2
Synonyms
  1. 6-phosphofructo-2-kinase
  2. 6PF-2-K/Fru-2,6-P2ase 2
  3. 6PF-2-K/Fru-2,6-P2ase heart-type isozyme
  4. Fructose-2,6-bisphosphatase
  5. PFK/FBPase 2
Gene Name PFKFB2
Protein Type Enzyme
Biological Properties
General Function Involved in catalytic activity
Specific Function Synthesis and degradation of fructose 2,6-bisphosphate.
Pathways
  • Fructose and mannose metabolism
  • HIF-1 signaling pathway
Reactions
D-Fructose 2,6-bisphosphate + Water → Fructose 6-phosphate + Phosphoric acid details
Adenosine triphosphate + Fructose 6-phosphate → ADP + D-Fructose 2,6-bisphosphate details
D-Fructose 2,6-bisphosphate + Water → Beta-D-Fructose 6-phosphate + Phosphoric acid details
GO Classification
Biological Process
small molecule metabolic process
fructose metabolic process
glycolysis
positive regulation of insulin secretion
pyruvate metabolic process
response to glucose stimulus
positive regulation of glucokinase activity
fructose 2,6-bisphosphate metabolic process
lactate metabolic process
Cellular Component
cytosol
Function
binding
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
phosphotransferase activity, alcohol group as acceptor
phosphofructokinase activity
6-phosphofructo-2-kinase activity
Molecular Function
ATP binding
fructose-2,6-bisphosphate 2-phosphatase activity
6-phosphofructo-2-kinase activity
Process
metabolic process
small molecule metabolic process
alcohol metabolic process
monosaccharide metabolic process
hexose metabolic process
fructose metabolic process
fructose 2,6-bisphosphate metabolic process
Cellular Location Not Available
Gene Properties
Chromosome Location 1
Locus 1q31
SNPs PFKFB2
Gene Sequence
>1518 bp
ATGTCTGGGGCATCTTCCTCAGAACAGAACAACAACAGCTATGAAACCAAAACCCCAAAT
CTTCGAATGTCAGAGAAGAAATGTTCATGGGCCTCCTACATGACCAACTCCCCGACTCTG
ATCGTTATGATTGGTTTGCCAGCCCGGGGTAAAACCTACGTGTCCAAGAAACTAACACGC
TACCTCAACTGGATTGGAGTCCCCACCAAAGTGTTTAATCTTGGGGTGTATCGGCGTGAA
GCAGTCAAGTCCTATAAGTCCTACGACTTCTTTCGGCATGACAATGAGGAGGCCATGAAG
ATCCGCAAACAGTGTGCTCTGGTGGCGCTGGAAGATGTTAAGGCGTATCTCACTGAGGAG
AATGGTCAGATTGCGGTGTTTGATGCCACCAATACAACCCGGGAGAGGAGGGACATGATT
TTGAACTTTGCTGAACAGAATTCCTTCAAGGTATTCTTTGTGGAATCCGTCTGTGATGAT
CCTGATGTCATTGCTGCCAATATTCTGGAGGTTAAGGTATCAAGCCCTGACTATCCTGAA
AGGAACAGAGAGAACGTGATGGAGGACTTCCTGAAGAGAATTGAATGCTACAAAGTTACC
TACCGACCTCTTGACCCAGACAACTATGACAAGGATCTTTCTTTCATCAAGGTGATAAAC
GTGGGCCAGCGATTTTTAGTCAACAGAGTCCAGGACTACATCCAGAGCAAGATAGTCTAC
TACCTCATGAATATCCACGTCCAGCCTCGCACCATTTACCTTTGCCGGCATGGAGAAAGC
GAGTTCAATCTCTTGGGGAAGATTGGGGGTGACTCTGGCCTCTCGGTGCGGGGAAAGCAG
TTTGCCCAAGCTCTAAGGAAATTTCTGGAGGAACAGGAAATAACAGACCTCAAAGTGTGG
ACAAGCCAGTTGAAGAGGACCATACAGACTGCTGAATCTCTCGGGGTGCCCTATGAGCAG
TGGAAGATTCTGAATGAGATTGATGCTGGTGTGTGTGAAGAGATGACCTATGCAGAGATT
GAGAAACGGTACCCAGAAGAGTTTGCACTTCGAGATCAAGAGAAGTATCTGTATCGATAT
CCTGGTGGGGAGTCATACCAGGACCTGGTGCAGCGGCTGGAGCCTGTCATCATGGAGCTG
GAACGTCAGGGCAATGTCCTCGTCATCTCCCACCAGGCTGTCATGCGCTGCCTCCTGGCC
TACTTCTTGGATAAGGGCGCAGATGAGCTACCATACTTGAGATGCCCTCTCCATACCATC
TTCAAACTTACTCCTGTGGCCTATGGGTGCAAAGTGGAAACAATTAAACTTAACGTGGAG
GCTGTGAACACGCACCGTGACAAGCCAACTAACAACTTCCCCAAGAACCAAACCCCTGTA
AGGATGAGAAGGAACAGCTTTACGCCTCTGTCCAGTTCGAATACAATAAGGCGTCCAAGA
AATTACAGTGTTGGGAGCCGGCCCCTCAAGCCCCTCAGCCCTCTCCGTGCCCAGGACATG
CAAGAAGGGGCCGACTAG
Protein Properties
Number of Residues 505
Molecular Weight 54405.88
Theoretical pI 7.564
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 2
MSGASSSEQNNNSYETKTPNLRMSEKKCSWASYMTNSPTLIVMIGLPARGKTYVSKKLTR
YLNWIGVPTKVFNLGVYRREAVKSYKSYDFFRHDNEEAMKIRKQCALVALEDVKAYLTEE
NGQIAVFDATNTTRERRDMILNFAEQNSFKVFFVESVCDDPDVIAANILEVKVSSPDYPE
RNRENVMEDFLKRIECYKVTYRPLDPDNYDKDLSFIKVINVGQRFLVNRVQDYIQSKIVY
YLMNIHVQPRTIYLCRHGESEFNLLGKIGGDSGLSVRGKQFAQALRKFLEEQEITDLKVW
TSQLKRTIQTAESLGVPYEQWKILNEIDAGVCEEMTYAEIEKRYPEEFALRDQEKYLYRY
PGGESYQDLVQRLEPVIMELERQGNVLVISHQAVMRCLLAYFLDKGADELPYLRCPLHTI
FKLTPVAYGCKVETIKLNVEAVNTHRDKPTNNFPKNQTPVRMRRNSFTPLSSSNTIRRPR
NYSVGSRPLKPLSPLRAQDMQEGAD
GenBank ID Protein 64762406
UniProtKB/Swiss-Prot ID O60825
UniProtKB/Swiss-Prot Entry Name F262_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_006212.2
GeneCard ID PFKFB2
GenAtlas ID PFKFB2
HGNC ID HGNC:8873
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [PubMed:16710414 ]
  3. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  4. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  5. Yu LR, Zhu Z, Chan KC, Issaq HJ, Dimitrov DS, Veenstra TD: Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra. J Proteome Res. 2007 Nov;6(11):4150-62. Epub 2007 Oct 9. [PubMed:17924679 ]
  6. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  7. Heine-Suner D, Diaz-Guillen MA, Lange AJ, Rodriguez de Cordoba S: Sequence and structure of the human 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase heart isoform gene (PFKFB2). Eur J Biochem. 1998 May 15;254(1):103-10. [PubMed:9652401 ]
  8. Soejima H, Kawamoto S, Akai J, Miyoshi O, Arai Y, Morohka T, Matsuo S, Niikawa N, Kimura A, Okubo K, Mukai T: Isolation of novel heart-specific genes using the BodyMap database. Genomics. 2001 May 15;74(1):115-20. [PubMed:11374908 ]