You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP00835
Secondary Accession Numbers
  • 6116
Name Glycerol kinase 2
Synonyms
  1. ATP:glycerol 3-phosphotransferase 2
  2. GK 2
  3. Glycerokinase 2
  4. Glycerol kinase, testis specific 2
Gene Name GK2
Protein Type Enzyme
Biological Properties
General Function Involved in phosphotransferase activity, alcohol group as acceptor
Specific Function Key enzyme in the regulation of glycerol uptake and metabolism (By similarity).
Pathways
  • glycerol degradation via glycerol kinase pathway
  • Glycerolipid metabolism
  • PPAR signaling pathway
Reactions
Adenosine triphosphate + Glycerol → ADP + Glycerol 3-phosphate details
GO Classification
Biological Process
glycerol metabolic process
glycerol catabolic process
glycerol-3-phosphate metabolic process
Cellular Component
mitochondrial outer membrane
Function
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
phosphotransferase activity, alcohol group as acceptor
glycerol kinase activity
Molecular Function
ATP binding
glycerol kinase activity
Process
metabolic process
primary metabolic process
carbohydrate metabolic process
small molecule metabolic process
alcohol metabolic process
polyol metabolic process
alditol metabolic process
glycerol metabolic process
glycerol-3-phosphate metabolic process
Cellular Location
  1. Cytoplasm
  2. Peripheral membrane protein
  3. Cytoplasmic side
  4. Mitochondrion outer membrane
Gene Properties
Chromosome Location 4
Locus 4q13
SNPs GK2
Gene Sequence
>1662 bp
ATGGCAGCCCCGAAGACAGCAGCTGTGGGGCCGTTGGTGGGAGCGGTGGTCCAGGGCACC
AACTCCACTCGCTTTCTGGTTTTCAATTCAAAAACAGCGGAACTACTTAGTCATCACAAA
GTGGAATTAACACAAGAGTTCCCAAAAGAAGGATGGGTGGAACAAGACCCTAAAGAAATT
CTTCAGTCTGTCTACGAGTGTATAGCGAGAACGTGTGAGAAACTTGACGAACTGAATATT
GATATATCCAACATAAAAGCTGTTGGTGTCAGCAATCAGAGGGAAACCACTGTAATCTGG
GACAAGTTAACAGGAGAGCCTCTCTACAATGCTGTGGTGTGGCTTGATCTAAGAACCCAG
ACTACTGTTGAGGATCTTAGTAAAAAAATTCCAGGAAATAGTAACTTCGTCAAGTCTAAG
ACAGGCCTTCCACTCAGCACTTACTTCAGTGCAGTAAAACTTCGTTGGATGCTTGACAAT
GTGAGAAACGTCCAAAAGGCTGTTGAAGAAGGTAGAGCTCTTTTTGGTACCATTGATTCA
TGGCTTATCTGGAGTTTGACAGGAGGAGTTAATGGAGGCGTGCATTGTACAGATGTAACA
AATGCAAGTAGGACAATGCTTTTTAATATCCATTCTTTGGAATGGGATAAAGAGCTCTGT
GACTTTTTTGAAATTCCAATGGACCTTCTTCCAAATGTCTTCAGTTCTTCTGGGATCTAT
GGCCTAATTAAAACTGGAGCCCTGGAAGGTGTGCCAATATCTGGGTGTTTGGGGGACCAA
TGTGCTGCATTAGTAGGACAAATGTGCTTCCAGGAGGGACAAGCCAAAAACACCTATGGA
ACAGGTTGCTTCTTACTGTGTAATACGGGTCGTAAATGTGTGTTTTCTGAACATGGCCTT
TTGACCACAGTAGCTTACAAACTAGGCAGAGAGAAGCCAGCATATTATGCACTGGAAGGT
TCTGTTGCTATAGCAGGTGCTGTTATTCGTTGGCTAAGAGACAATCTTGGAATTATAGAG
ACCTCAGGAGACATTGAAAGACTTGCTAAAGAAGTAGGAACTTCTTATGGCTGTTACTTT
GTCCCAGCCTTTTCAGGGTTATATACACCTTATTGGGAGCCTAGTGCAAGAGGGATACTC
TGTGGCCTCACTCAGTTTACCAATAAATGTCATATTGCTTTTGCTGCATTAGAAGCTGTT
TGTTTCCAAACCCGAGAGATTTTGGAAGCCATGAACCGTGACTGTGGAATTCCACTTCGT
CATTTGCAGGTAGATGGAGGAATGACCAACAACAAAGTTCTTATGCAGCTACAAGCAGAT
ATTCTTCATATTCCAGTAATAAAACCCTTTATGCCTGAAACAACTGCACTAGGAGCTGCC
ATGGCAGCAGGGGCTGCAGAGGGAGTAAGCGTTTGGAGCCTTGAACCCCAGGCTTTGTCA
GTTCTCAGGATGGAACGATTTGAACCACAGATCCAGGCCACAGAAAGTGAAATTTGTTAT
GCCACATGGAAGAAAGCCGTAATGAAGTCAATGGGTTGGGTTACCAGTCAGTCTCCTGAA
GGTGGTGATCCTTCTATCTTCTCTAGTCTGCCTTTGGGATTTTTTATAGTGAGTAGCATG
GTAATGCTAATTGGAGCAAGATATATCTCGGGTGTGCCATAA
Protein Properties
Number of Residues 553
Molecular Weight 60593.32
Theoretical pI 5.776
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Glycerol kinase 2
MAAPKTAAVGPLVGAVVQGTNSTRFLVFNSKTAELLSHHKVELTQEFPKEGWVEQDPKEI
LQSVYECIARTCEKLDELNIDISNIKAVGVSNQRETTVIWDKLTGEPLYNAVVWLDLRTQ
TTVEDLSKKIPGNSNFVKSKTGLPLSTYFSAVKLRWMLDNVRNVQKAVEEGRALFGTIDS
WLIWSLTGGVNGGVHCTDVTNASRTMLFNIHSLEWDKELCDFFEIPMDLLPNVFSSSEIY
GLIKTGALEGVPISGCLGDQCAALVGQMCFQEGQAKNTYGTGCFLLCNTGRKCVFSEHGL
LTTVAYKLGREKPAYYALEGSVAIAGAVIRWLRDNLGIIETSGDIERLAKEVGTSYGCYF
VPAFSGLYAPYWEPSARGILCGLTQFTNKCHIAFAALEAVCFQTREILEAMNRDCGIPLR
HLQVDGGMTNNKVLMQLQADILHIPVIKPFMPETTALGAAMAAGAAEGVSVWSLEPQALS
VLRMERFEPQIQATESEIRYATWKKAVMKSMGWVTSQSPEGGDPSIFSSLPLGFFIVSSM
VMLIGARYISGVP
GenBank ID Protein 158257914
UniProtKB/Swiss-Prot ID Q14410
UniProtKB/Swiss-Prot Entry Name GLPK2_HUMAN
PDB IDs Not Available
GenBank Gene ID AK292241
GeneCard ID GK2
GenAtlas ID GK2
HGNC ID HGNC:4291
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Sargent CA, Young C, Marsh S, Ferguson-Smith MA, Affara NA: The glycerol kinase gene family: structure of the Xp gene, and related intronless retroposons. Hum Mol Genet. 1994 Aug;3(8):1317-24. [PubMed:7987308 ]