You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP00846
Secondary Accession Numbers
  • 6127
  • HMDBP05932
Name Testosterone 17-beta-dehydrogenase 3
Synonyms
  1. 17-beta-HSD 3
  2. 17-beta-hydroxysteroid dehydrogenase type 3
  3. Testicular 17-beta-hydroxysteroid dehydrogenase
Gene Name HSD17B3
Protein Type Enzyme
Biological Properties
General Function Involved in oxidoreductase activity
Specific Function Favors the reduction of androstenedione to testosterone. Uses NADPH while the two other EDH17B enzymes use NADH.
Pathways
  • 17-Beta Hydroxysteroid Dehydrogenase III Deficiency
  • Androgen and Estrogen Metabolism
  • Androstenedione Metabolism
  • Aromatase deficiency
  • Steroid hormone biosynthesis
  • testosterone biosynthesis
Reactions
Testosterone + NADP → Androstenedione + NADPH details
Testosterone + NADP → Androstenedione + NADPH + Hydrogen Ion details
GO Classification
Biological Process
small molecule metabolic process
response to arsenic-containing substance
response to cadmium ion
biphenyl metabolic process
cellular response to antibiotic
hippocampus development
Leydig cell differentiation
phenol-containing compound metabolic process
response to fungicide
response to L-ascorbic acid
cellular response to gonadotropin stimulus
response to ethanol
insecticide metabolic process
organic acid metabolic process
testosterone biosynthetic process
male genitalia development
response to activity
response to fatty acid
response to lead ion
response to corticosterone stimulus
response to herbicide
response to vitamin E
androgen biosynthetic process
response to estrogen stimulus
Cellular Component
endoplasmic reticulum membrane
Function
binding
catalytic activity
oxidoreductase activity
Molecular Function
testosterone 17-beta-dehydrogenase (NADP+) activity
estradiol 17-beta-dehydrogenase activity
testosterone 17-beta-dehydrogenase (NAD+) activity
nucleotide binding
Process
metabolic process
oxidation reduction
Cellular Location Not Available
Gene Properties
Chromosome Location 9
Locus 9q22
SNPs HSD17B3
Gene Sequence
>933 bp
ATGGGGGACGTCCTGGAACAGTTCTTCATCCTCACAGGGCTGCTGGTGTGCCTGGCCTGC
CTGGCGAAGTGCGTGAGATTCTCCAGATGTGTTTTACTGAACTACTGGAAAGTTTTGCCA
AAGTCTTTCTTGCGGTCAATGGGACAGTGGGCAGTGATCACTGGAGCAGGCGATGGAATT
GGGAAAGCGTACTCGTTCGAGCTAGCAAAACGTGGACTCAATGTTGTCCTTATTAGCCGG
ACGCTGGAAAAACTAGAGGCCATTGCCACAGAGATCGAGCGGACTACAGGGAGGAGTGTG
AAGATTATACAAGCAGATTTTACAAAAGATGACATCTACGAGCATATTAAAGAAAAACTT
GCAGGCTTAGAAATTGGAATTTTAGTCAACAATGTCGGAATGCTTCCAAACCTTCTCCCA
AGCCATTTCCTGAACGCACCGGATGAAATCCAGAGCCTCATCCATTGTAACATCACCTCC
GTAGTCAAGATGACACAGCTAATTCTGAAACATATGGAATCAAGGCAGAAAGGTCTCATC
CTGAACATTTCTTCTGGGATAGCCCTGTTTCCTTGGCCTCTCTACTCCATGTACTCAGCT
TCCAAGGCGTTTGTGTGCGCATTTTCCAAGGCCCTGCAAGAGGAATATAAAGCAAAAGAA
GTCATCATCCAGGTGCTGACCCCATATGCTGTCTCGACTGCAATGACAAAGTATCTAAAT
ACAAATGTGATAACCAAGACTGCTGATGAGTTTGTCAAAGAGTCATTGAATTATGTCACA
ATTGGAGGTGAAACCTGTGGCTGCCTTGCCCATGAAATCTTGGCGGGCTTTCTGAGCCTG
ATCCCGGCCTGGGCCTTCTACAGCGGTGCCTTCCAAAGGCTGCTCCTGACACACTATGTG
GCATACCTGAAGCTCAACACCAAGGTCAGGTAG
Protein Properties
Number of Residues 310
Molecular Weight 34515.345
Theoretical pI 8.66
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Testosterone 17-beta-dehydrogenase 3
MGDVLEQFFILTGLLVCLACLAKCVRFSRCVLLNYWKVLPKSFLRSMGQWAVITGAGDGI
GKAYSFELAKRGLNVVLISRTLEKLEAIATEIERTTGRSVKIIQADFTKDDIYEHIKEKL
AGLEIGILVNNVGMLPNLLPSHFLNAPDEIQSLIHCNITSVVKMTQLILKHMESRQKGLI
LNISSGIALFPWPLYSMYSASKAFVCAFSKALQEEYKAKEVIIQVLTPYAVSTAMTKYLN
TNVITKTADEFVKESLNYVTIGGETCGCLAHEILAGFLSLIPAWAFYSGAFQRLLLTHYV
AYLKLNTKVR
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID P37058
UniProtKB/Swiss-Prot Entry Name DHB3_HUMAN
PDB IDs Not Available
GenBank Gene ID U05659
GeneCard ID HSD17B3
GenAtlas ID HSD17B3
HGNC ID HGNC:5212
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Geissler WM, Davis DL, Wu L, Bradshaw KD, Patel S, Mendonca BB, Elliston KO, Wilson JD, Russell DW, Andersson S: Male pseudohermaphroditism caused by mutations of testicular 17 beta-hydroxysteroid dehydrogenase 3. Nat Genet. 1994 May;7(1):34-9. [PubMed:8075637 ]
  3. Andersson S, Geissler WM, Wu L, Davis DL, Grumbach MM, New MI, Schwarz HP, Blethen SL, Mendonca BB, Bloise W, Witchel SF, Cutler GB Jr, Griffin JE, Wilson JD, Russel DW: Molecular genetics and pathophysiology of 17 beta-hydroxysteroid dehydrogenase 3 deficiency. J Clin Endocrinol Metab. 1996 Jan;81(1):130-6. [PubMed:8550739 ]
  4. Bilbao JR, Loridan L, Audi L, Gonzalo E, Castano L: A novel missense (R80W) mutation in 17-beta-hydroxysteroid dehydrogenase type 3 gene associated with male pseudohermaphroditism. Eur J Endocrinol. 1998 Sep;139(3):330-3. [PubMed:9758445 ]
  5. Moghrabi N, Hughes IA, Dunaif A, Andersson S: Deleterious missense mutations and silent polymorphism in the human 17beta-hydroxysteroid dehydrogenase 3 gene (HSD17B3). J Clin Endocrinol Metab. 1998 Aug;83(8):2855-60. [PubMed:9709959 ]
  6. Lindqvist A, Hughes IA, Andersson S: Substitution mutation C268Y causes 17 beta-hydroxysteroid dehydrogenase 3 deficiency. J Clin Endocrinol Metab. 2001 Feb;86(2):921-3. [PubMed:11158067 ]