You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP00868
Secondary Accession Numbers
  • 6150
Name Mannosyl-oligosaccharide 1,2-alpha-mannosidase IB
Synonyms
  1. Alpha-1,2-mannosidase IB
  2. Mannosidase alpha class 1A member 2
  3. Processing alpha-1,2-mannosidase IB
Gene Name MAN1A2
Protein Type Unknown
Biological Properties
General Function Involved in mannosyl-oligosaccharide 1,2-alpha-mannosidase activity
Specific Function Involved in the maturation of Asn-linked oligosaccharides. Progressively trim alpha-1,2-linked mannose residues from Man(9)GlcNAc(2) to produce Man(5)GlcNAc(2).
Pathways
  • N-Glycan biosynthesis
  • protein glycosylation
  • Protein processing in endoplasmic reticulum
Reactions
+ Water → + D-Mannose details
Water + → D-Mannose + details
GO Classification
Biological Process
N-glycan processing
respiratory gaseous exchange
post-translational protein modification
protein N-linked glycosylation via asparagine
lung alveolus development
Cellular Component
nucleolus
integral to membrane
Golgi membrane
Component
membrane
cell part
Function
mannosidase activity
mannosyl-oligosaccharide mannosidase activity
ion binding
mannosyl-oligosaccharide 1,2-alpha-mannosidase activity
cation binding
metal ion binding
binding
catalytic activity
hydrolase activity
hydrolase activity, acting on glycosyl bonds
hydrolase activity, hydrolyzing o-glycosyl compounds
calcium ion binding
Molecular Function
mannosyl-oligosaccharide 1,2-alpha-mannosidase activity
calcium ion binding
Cellular Location
  1. Golgi apparatus membrane
  2. Single-pass type II membrane protein
Gene Properties
Chromosome Location 1
Locus 1p13
SNPs MAN1A2
Gene Sequence
>1926 bp
ATGACTACCCCAGCCCTGCTGCCCCTCTCTGGACGTAGGATACCACCTCTGAACCTGGGG
CCGCCTTCCTTCCCACATCACAGGGCTACCTTGAGACTTTCTGAGAAGTTTATTCTTCTC
CTTATTCTTAGTGCCTTCATCACTCTGTGTTTTGGGGCATTCTTTTTCCTTCCAGACTCT
TCAAAACACAAACGCTTTGATTTGGGTTTAGAAGATGTGTTAATTCCACATGTAGATGCC
GGTAAAGGGGCTAAAAACCCCGGAGTCTTCCTGATCCATGGACCCGATGAACATAGACAC
AGGGAAGAGGAAGAACGTCTGAGAAATAAAATTCGAGCTGATCATGAGAAGGCCTTGGAA
GAAGCAAAAGAAAAATTAAGAAAGTCAAGAGAGGAAATTCGAGCAGAAATTCAGACAGAG
AAAAATAAGGTAGTCCAAGAAATGAAGATAAAAGAGAACAAGCCACTGCCACCAGTCCCT
ATTCCCAACCTTGTAGGAATACGTGGTGGAGACCCAGAAGATAATGACATAAGAGAGAAA
AGGGAAAAAATTAAAGAGATGATGAAACATGCTTGGGATAACTATAGGACATATGGGTGG
GGACATAATGAACTCAGACCTATTGCAAGGAAAGGACACTCCCCTAACATATTTGGAAGT
TCACAAATGGGTGCTACCATAGTAGATGCTTTGGATACCCTTTATATCATGGGACTTCAT
GATGAATTCCTAGATGGGCAAAGATGGATTGAAGACAACCTTGATTTCAGTGTGAATTCA
GAGGTGTCTGTGTTTGAAGTCAACATTCGATTTATTGGAGGCCTACTTGCAGCATATTAC
CTATCAGGAGAGGAGATATTCAAGATTAAAGCAGTGCAATTGGCTGAGAAACTCCTTCCT
GCCTTTAACACACCTACTGGGATTCCTTGGGCAATGGTGAATTTGAAAAGTGGAGTAGGG
CGAAACTGGGGCTGGGCATCTGCAGGTAGCAGCATTCTGGCTGAATTTGGTACACTACAT
ATGGAGTTCATCCACCTCAGCTACTTGACAGGGGACCTGACTTACTACAAAAAGGTTATG
CACATTCGGAAACTACTTCAGAAAATGGATCGTCCAAATGGTCTTTATCCAAATTATTTG
AACCCCAGAACAGGGCGCTGGGGTCAGTATCATACATCTGTCGGTGGCCTGGGAGACAGT
TTTTATGAATACTTACTGAAAGCATGGTTGATGTCAGATAAAACAGACCATGAGGCAAGA
AAGATGTATGATGATGCTATTGAGGCTATAGAAAAACATCTTATTAAGAAGTCTCGTGGA
GGTCTTACCTTTATTGGAGAATGGAAGAATGGGCACTTGGAAAAAAAGATGGGGCATTTG
GCCTGCTTTGCTGGGGGAATGTTTGCACTAGGAGCAGATGGTTCCAGAGCAGATAAAGCT
GGTCATTATTTAGAGCTAGGGGCAGAAATTGCACGTACTTGTCATGAGTCATATGACAGA
ACTGCATTAAAGCTAGGTCCTGAATCATTCAAGTTTGATGGTGCAGTGGAGGCTGTGGCT
GTCCGGCAGGCTGAAAAGTATTATATCCTCCGTCCAGAAGTAATTGAAACCTATTGGTAC
CTATGGCGATTCACTCACGATCCAAGATACAGGCAGTGGGGCTGGGAAGCAGCACTGGCC
ATTGAAAAGTATTGCCGAGTTAATGGTGGGTTTTCTGGAGTCAAAGATGTATATTCCTCT
ACTCCTACACATGATGATGTACAGCAGAGCTTTTTTCTTGCTGAAACATTAAAATATTTG
TATCTGCTGTTCTCCGGTGATGACCTTTTACCTTTAGACCACTGGGTGTTTAATACAGAG
GCTCACCCTCTGCCTGTGTTACATTTAGCCAACACCACACTTTCAGGTAATCCTGCTGTT
CGATGA
Protein Properties
Number of Residues 641
Molecular Weight 73002.93
Theoretical pI 7.605
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Mannosyl-oligosaccharide 1,2-alpha-mannosidase IB
MTTPALLPLSGRRIPPLNLGPPSFPHHRATLRLSEKFILLLILSAFITLCFGAFFFLPDS
SKHKRFDLGLEDVLIPHVDAGKGAKNPGVFLIHGPDEHRHREEEERLRNKIRADHEKALE
EAKEKLRKSREEIRAEIQTEKNKVVQEMKIKENKPLPPVPIPNLVGIRGGDPEDNDIREK
REKIKEMMKHAWDNYRTYGWGHNELRPIARKGHSPNIFGSSQMGATIVDALDTLYIMGLH
DEFLDGQRWIEDNLDFSVNSEVSVFEVNIRFIGGLLAAYYLSGEEIFKIKAVQLAEKLLP
AFNTPTGIPWAMVNLKSGVGRNWGWASAGSSILAEFGTLHMEFIHLSYLTGDLTYYKKVM
HIRKLLQKMDRPNGLYPNYLNPRTGRWGQYHTSVGGLGDSFYEYLLKAWLMSDKTDHEAR
KMYDDAIEAIEKHLIKKSRGGLTFIGEWKNGHLEKKMGHLACFAGGMFALGADGSRADKA
GHYLELGAEIARTCHESYDRTALKLGPESFKFDGAVEAVAVRQAEKYYILRPEVIETYWY
LWRFTHDPRYRQWGWEAALAIEKYCRVNGGFSGVKDVYSSTPTHDDVQQSFFLAETLKYL
YLLFSGDDLLPLDHWVFNTEAHPLPVLHLANTTLSGNPAVR
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID O60476
UniProtKB/Swiss-Prot Entry Name MA1A2_HUMAN
PDB IDs Not Available
GenBank Gene ID AF027156
GeneCard ID MAN1A2
GenAtlas ID MAN1A2
HGNC ID HGNC:6822
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [PubMed:16710414 ]
  3. Tremblay LO, Campbell Dyke N, Herscovics A: Molecular cloning, chromosomal mapping and tissue-specific expression of a novel human alpha1,2-mannosidase gene involved in N-glycan maturation. Glycobiology. 1998 Jun;8(6):585-95. [PubMed:9592125 ]