You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP00873
Secondary Accession Numbers
  • 6155
Name Beta-1,4 N-acetylgalactosaminyltransferase 1
Synonyms
  1. (N-acetylneuraminyl)-galactosylglucosylceramide
  2. GM2/GD2 synthase
  3. GalNAc-T
Gene Name B4GALNT1
Protein Type Enzyme
Biological Properties
General Function Involved in transferase activity, transferring hexosyl groups
Specific Function Involved in the biosynthesis of gangliosides GM2, GD2 and GA2.
Pathways
  • Glycosphingolipid biosynthesis - ganglio series
  • protein glycosylation
Reactions
UDP-N-acetyl-alpha-D-galactosamine + O-(N-acetyl-alpha-neuraminyl)-(2->3)-O-beta-D-galactopyranosyl-(1->4)-beta-D-glucopyranosyl-(1<->1)-ceramide → Uridine 5'-diphosphate + O-2-(acetylamino)-2-deoxy-beta-D-galactopyranosyl-(1->4)-O-(N-acetyl-alpha-neuraminyl-(2->3))-O-beta-D-galactopyranosyl-(1->4)-beta-D-glucopyranosyl-(1<->1)-ceramide details
UDP-N-acetyl-D-galactosamine + Lactosylceramide → UDP + GA2 details
UDP-N-acetyl-D-galactosamine + GM3 → UDP + GM2 details
UDP-N-acetyl-D-galactosamine + GD3 → UDP + GD2 details
UDP-N-acetyl-D-galactosamine + GT3 → UDP + GT2 details
GO Classification
Biological Process
spermatogenesis
ganglioside biosynthetic process
lipid storage
lipid glycosylation
protein glycosylation
carbohydrate metabolic process
glycosphingolipid metabolic process
Cellular Component
plasma membrane
integral to Golgi membrane
membrane
Component
cell part
membrane part
intrinsic to membrane
intrinsic to organelle membrane
intrinsic to golgi membrane
integral to golgi membrane
Function
catalytic activity
transferase activity
transferase activity, transferring hexosyl groups
transferase activity, transferring glycosyl groups
Molecular Function
(N-acetylneuraminyl)-galactosylglucosylceramide N-acetylgalactosaminyltransferase activity
Process
lipid modification
lipid glycosylation
metabolic process
primary metabolic process
lipid metabolic process
cellular lipid metabolic process
Cellular Location
  1. Golgi apparatus membrane
  2. Single-pass type II membrane protein
Gene Properties
Chromosome Location 12
Locus 12q13.3
SNPs B4GALNT1
Gene Sequence
>1602 bp
ATGTGGCTGGGCCGCCGGGCCCTGTGCGCTCTGGTCCTTCTGCTCGCCTGCGCCTCGCTG
GGGCTCCTGTACGCGAGCACCCGGGACGCGCCCGGCCTCCGGCTACCTCTTGCGCCGTGG
GCGCCCCCGCAAAGCCCCCGCAGGCCCGAGCTGCCAGATCTTGCTCCTGAGCCCCGCTAC
GCACACATCCCGGTCAGGATCAAGGAGCAAGTAGTGGGGCTGCTGGCTTGGAACAACTGC
AGTTGTGAGTCCAGTGGGGGGGGCCTCCCCCTCCCCTTCCAGAAACAAGTCCGAGCTATT
GACCTCACCAAGGCCTTTGACCCTGCAGAGCTGAGGGCTGCCTCTGCCACAAGAGAGCAG
GAGTTCCAGGCCTTTCTGTCGAGGAGCCAGTCCCCAGCTGACCAGCTGCTCATAGCCCCT
GCCAACTCCCCGCTCCAGTACCCCCTACAGGGTGTGGAAGTTCAGCCCCTCAGGAGCATC
TTGGTGCCAGGGCTGAGCCTTCAGGCAGCTTCTGGTCAGGAGGTATACCAGGTGAACCTG
ACTGCCTCCCTAGGCACCTGGGACGTGGCAGGGGAAGTGACTGGAGTTACTCTCACTGGA
GAGGGTCAGGCAGATCTCACCCTTGTCAGCCCAGGGCTGGACCAACTCAACAGGCAACTA
CAACTGGTCACTTACAGCAGCCGAAGCTACCAGACCAACACAGCAGACACAGTCCGGTTC
TCCACCGAGGGACATGAGGCTGCTTTCACTATCCGCATAAGACACCCGCCCAACCCTCGG
CTGTACCCACCTGGGTCTCTACCCCAGGGAGCCCAGTACAACATCAGCGCTCTAGTCACG
ATTGCCACCAAGACCTTCCTCCGTTATGATCGGCTACGGGCTCTCATCACCAGTATCCGC
CGCTTCTACCCAACGGTTACCGTGGTCATCGCTGACGACAGCGACAAGCCAGAGCGCGTT
AGTGGCCCCTACGTGGAACACTATCTCATGCCCTTCGGCAAGGGCTGGTTCGCAGGCCGG
AACCTGGCCGTGTCTCAAGTAACCACCAAGTACGTGCTGTGGGTGGACGACGACTTCGTC
TTCACGGCGCGGACGCGGCTGGAGAGGCTTGTGGACGTGCTGGAGCGGACGCCGCTGGAC
CTGGTGGGGGGCGCGGTGCGCGAGATCTCCGGCTTTGCCACCACTTATCGGCAGCTGCTG
AGCGTGGAGCCCGGCGCCCCAGGCCTCGGGAACTGCCTCCGGCAAAGGCGCGGCTTCCAC
CACGAGCTCGTCGGCTTCCCAGGCTGCGTGGTCACCGACGGCGTGGTTAACTTCTTCCTG
GCGCGGACTGACAAGGTGCGCGAGGTCGGTTTCGACCCCCGCCTCAGCCGCGTGGCTCAT
CTGGAATTCTTCTTGGATGGGCTTGGTTCCCTTCGGGTTGGCTCCTGCTCCGACGTCGTG
GTGGATCATGCATCCAAACTGAAGCTGCCTTGGACATCAAGGGATGCCGGAGCAGAGACT
TACGCCCGGTACCGTTACCCAGGATCACTGGACGAGAGCCAGATGGCCAAACACCGGCTG
CTCTTCTTCAAACACCGGCTGCAGTGCATGACCTCCCAGTGA
Protein Properties
Number of Residues 533
Molecular Weight 58881.78
Theoretical pI 8.69
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Beta-1,4 N-acetylgalactosaminyltransferase 1
MWLGRRALCALVLLLACASLGLLYASTRDAPGLRLPLAPWAPPQSPRRPELPDLAPEPRY
AHIPVRIKEQVVGLLAWNNCSCESSGGGLPLPFQKQVRAIDLTKAFDPAELRAASATREQ
EFQAFLSRSQSPADQLLIAPANSPLQYPLQGVEVQPLRSILVPGLSLQAASGQEVYQVNL
TASLGTWDVAGEVTGVTLTGEGQADLTLVSPGLDQLNRQLQLVTYSSRSYQTNTADTVRF
STEGHEAAFTIRIRHPPNPRLYPPGSLPQGAQYNISALVTIATKTFLRYDRLRALITSIR
RFYPTVTVVIADDSDKPERVSGPYVEHYLMPFGKGWFAGRNLAVSQVTTKYVLWVDDDFV
FTARTRLERLVDVLERTPLDLVGGAVREISGFATTYRQLLSVEPGAPGLGNCLRQRRGFH
HELVGFPGCVVTDGVVNFFLARTDKVREVGFDPRLSRVAHLEFFLDGLGSLRVGSCSDVV
VDHASKLKLPWTSRDAGAETYARYRYPGSLDESQMAKHRLLFFKHRLQCMTSQ
GenBank ID Protein 431033
UniProtKB/Swiss-Prot ID Q00973
UniProtKB/Swiss-Prot Entry Name B4GN1_HUMAN
PDB IDs Not Available
GenBank Gene ID M83651
GeneCard ID B4GALNT1
GenAtlas ID B4GALNT1
HGNC ID HGNC:4117
References
General References
  1. Nagata Y, Yamashiro S, Yodoi J, Lloyd KO, Shiku H, Furukawa K: Expression cloning of beta 1,4 N-acetylgalactosaminyltransferase cDNAs that determine the expression of GM2 and GD2 gangliosides. J Biol Chem. 1992 Jun 15;267(17):12082-9. [PubMed:1601877 ]
  2. Nagata Y, Yamashiro S, Yodoi J, Lloyd KO, Shiku H, Furukawa K: Expression cloning of beta 1,4 N-acetylgalactosaminyltransferase cDNAs that determine the expression of GM2 and GD2 gangliosides. J Biol Chem. 1994 Mar 4;269(9):7045. [PubMed:8120069 ]
  3. Li J, Yen TY, Allende ML, Joshi RK, Cai J, Pierce WM, Jaskiewicz E, Darling DS, Macher BA, Young WW Jr: Disulfide bonds of GM2 synthase homodimers. Antiparallel orientation of the catalytic domains. J Biol Chem. 2000 Dec 29;275(52):41476-86. [PubMed:11018043 ]