You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP00906
Secondary Accession Numbers
  • 6194
Name Ecto-ADP-ribosyltransferase 3
Synonyms
  1. Mono(ADP-ribosyl)transferase 3
  2. NAD(P)(+)--arginine ADP-ribosyltransferase 3
  3. ADP-ribosyltransferase C2 and C3 toxin-like 3
  4. ARTC3
Gene Name ART3
Protein Type Unknown
Biological Properties
General Function Involved in NAD(P)+-protein-arginine ADP-ribosyltransferase activity
Specific Function Not Available
Pathways Not Available
Reactions
NAD + protein-L-arginine → Niacinamide + N(omega)-(ADP-D-ribosyl)-protein-L-arginine details
NADP + protein-L-arginine → Niacinamide + N(omega)-((2'-phospho-ADP)-D-ribosyl)-protein-L-arginine details
GO Classification
Biological Process
protein ADP-ribosylation
Cellular Component
anchored to membrane
integral to plasma membrane
Function
catalytic activity
transferase activity
nad(p)+-protein-arginine adp-ribosyltransferase activity
transferase activity, transferring pentosyl groups
transferase activity, transferring glycosyl groups
Molecular Function
NAD(P)+-protein-arginine ADP-ribosyltransferase activity
NAD+ ADP-ribosyltransferase activity
Process
metabolic process
macromolecule metabolic process
protein amino acid adp-ribosylation
post-translational protein modification
macromolecule modification
protein modification process
Cellular Location
  1. Cell membrane
  2. Lipid-anchor
  3. GPI-anchor
Gene Properties
Chromosome Location 4
Locus 4p15.1-p14
SNPs ART3
Gene Sequence
>1170 bp
ATGAAGACGGGACATTTTGAAATAGTCACCATGCTGCTGGCAACCATGATTCTAGTGGAC
ATTTTCCAGGTGAAGGCTGAAGTGTTAGACATGGCAGATAATGCATTTGATGATGAATAC
CTGAAATGTACGGACAGGATGGAAATTAAATACGTTCCCCAACTGCTAAAGGAGGAAAAA
GCAAGCCACCAGCAATTAGATACTGTGTGGGAAAATGCAAAAGCCAAATGGGCAGCCCGA
AAGACTCAAATCTTTCTCCCTATGAATTTTAAGGATAACCATGGAATAGCCCTGATGGCA
TATATTTCCGAAGCTCAAGAGCAAACTCCCTTTTACCATCTGTTCAGTGAAGCTGTGAAG
ATGGCTGGCCAATCTCGAGAAGATTATATCTATGGCTTCCAGTTCAAAGCTTTCCACTTT
TACCTCACAAGAGCCCTGCAGTTGCTGAGAAAACCTTGTGAGGCCAGTTCCAAAACTGTG
GTATATAGAACAAGCCAGGGCACTTCATTTACATTTGGAGGGCTAAACCAAGCCAGGTTT
GGCCATTTTACCTTGGCATATTCAGCCAAACCTCAGGCTGCTAATGACCAGCTCACTGTG
TTATCCATCTACACATGCCTTGGAGTTGACATTGAAAATTTTCTTGATAAAGAAAGTGAA
AGAATTACTTTAATACCTCTGAATGAGGTTTTTCAAGTGTCACAGGAGGGGGCTGGCAAT
AACCTTATCCTTCAAAGCATAAACAAGACCTGCAGCCATTATGAGTGTGCATTTCTAGGT
GGACTAAAAACCGAAAACTGTATTGAGAACCTAGAATATTTTCAACCCATCTATGTCTAC
AACCCTGGTGAGAAAAACCAGAAGCTTGAAGACCATAGTGAGAAAAACTGGAAGCTTGAA
GACCATGGTGAGAAAAACCAGAAGCTTGAAGACCATGGTGTGAAAATCCTTGAACCCACC
CAAATACCTGGAATGAAAATTCCAGAACCTTTTCCACTACCTGAAGATAAAAGTCAAGGA
AATATCAACAATCCTACTCCAGGTCCAGTTCCTGTTCCAGGTCCCAAAAGCCATCCTTCT
GCATCCTTGGGCAAACTGCTGCTTCCACAGTTTGGGATGGTCATCATTTTAATCAGTGTT
TCTGCTATAAATCTCTTTGTTGCTCTGTAG
Protein Properties
Number of Residues 389
Molecular Weight 43922.97
Theoretical pI 6.062
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Ecto-ADP-ribosyltransferase 3
MKTGHFEIVTMLLATMILVDIFQVKAEVLDMADNAFDDEYLKCTDRMEIKYVPQLLKEEK
ASHQQLDTVWENAKAKWAARKTQIFLPMNFKDNHGIALMAYISEAQEQTPFYHLFSEAVK
MAGQSREDYIYGFQFKAFHFYLTRALQLLRKPCEASSKTVVYRTSQGTSFTFGGLNQARF
GHFTLAYSAKPQAANDQLTVLSIYTCLGVDIENFLDKESERITLIPLNEVFQVSQEGAGN
NLILQSINKTCSHYECAFLGGLKTENCIENLEYFQPIYVYNPGEKNQKLEDHSEKNWKLE
DHGEKNQKLEDHGVKILEPTQIPGMKIPEPFPLPEDKSQGNINNPTPGPVPVPGPKSHPS
ASSGKLLLPQFGMVIILISVSAINLFVAL
GenBank ID Protein 14250010
UniProtKB/Swiss-Prot ID Q13508
UniProtKB/Swiss-Prot Entry Name NAR3_HUMAN
PDB IDs Not Available
GenBank Gene ID BC008397
GeneCard ID ART3
GenAtlas ID ART3
HGNC ID HGNC:725
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Levy I, Wu YQ, Roeckel N, Bulle F, Pawlak A, Siegrist S, Mattei MG, Guellaen G: Human testis specifically expresses a homologue of the rodent T lymphocytes RT6 mRNA. FEBS Lett. 1996 Mar 18;382(3):276-80. [PubMed:8605984 ]
  3. Koch-Nolte F, Haag F, Braren R, Kuhl M, Hoovers J, Balasubramanian S, Bazan F, Thiele HG: Two novel human members of an emerging mammalian gene family related to mono-ADP-ribosylating bacterial toxins. Genomics. 1997 Feb 1;39(3):370-6. [PubMed:9119374 ]