You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP00908
Secondary Accession Numbers
  • 6196
  • HMDBP09437
Name Ecto-ADP-ribosyltransferase 5
Synonyms
  1. Mono(ADP-ribosyl)transferase 5
  2. NAD(P)(+)--arginine ADP-ribosyltransferase 5
  3. ADP-ribosyltransferase C2 and C3 toxin-like 5
  4. ARTC5
Gene Name ART5
Protein Type Unknown
Biological Properties
General Function Involved in NAD(P)+-protein-arginine ADP-ribosyltransferase activity
Specific Function Not Available
Pathways Not Available
Reactions
NAD + protein-L-arginine → Niacinamide + N(omega)-(ADP-D-ribosyl)-protein-L-arginine details
NADP + protein-L-arginine → Niacinamide + N(omega)-((2'-phospho-ADP)-D-ribosyl)-protein-L-arginine details
GO Classification
Biological Process
protein ADP-ribosylation
Cellular Component
extracellular region
Function
catalytic activity
transferase activity
nad(p)+-protein-arginine adp-ribosyltransferase activity
transferase activity, transferring pentosyl groups
transferase activity, transferring glycosyl groups
Molecular Function
NAD(P)+-protein-arginine ADP-ribosyltransferase activity
NAD+ ADP-ribosyltransferase activity
NAD+ nucleosidase activity
Process
metabolic process
macromolecule metabolic process
protein amino acid adp-ribosylation
post-translational protein modification
biopolymer metabolism
biopolymer modification
protein modification
physiological process
metabolism
macromolecule metabolism
macromolecule modification
protein modification process
Cellular Location
  1. Secreted (Potential)
Gene Properties
Chromosome Location 11
Locus 11p15.4
SNPs ART5
Gene Sequence
>876 bp
ATGGCGCTGGCGGCTTTGATGATCGCCCTCGGCAGCCTCGGCCTCCACACCTGGCAGGCC
CAGGCTGTTCCCATCCTGCCCCTGGGCCTGGCTCCAGACACCTTTGACGATACCTATGTG
GGTTGTGCAGAGGAGATGGAGGAGAAGGCAGCCCCCCTGCTAAAGGAGGAAATGGCCCAC
CATGCCCTGCTGCGGGAATCCTGGGAGGCAGCCCAGGAGACCTGGGAGGACAAGCGTCGA
GGGCTTACCTTGCCCCCTGGCTTCAAAGCCCAGAATGGAATAGCCATTATGGTCTACACC
AACTCATCGAACACCTTGTACTGGGAGTTGAATCAGGCCGTGCGGACGGGCGGAGGCTCC
CGGGAGCTCTACATGAGGCACTTTCCCTTCAAGGCCCTGCATTTCTACCTGATCCGGGCC
CTGCAGCTGCTGCGAGGCAGTGGGGGCTGCAGCAGGGGACCTGGGGAGGTGGTGTTCCGA
GGTGTGGGCAGCCTTCGCTTTGAACCCAAGAGGCTGGGAGACTCTGTCCGCTTGGGCCAG
TTTGCCTCCAGCTCCCTGGATAAGGCAGTGGCCCACAGATTTGGTAATGCCACCCTCTTC
TCTCTAACAACTTGCTTTGGGGCCCCTATACAGGCCTTCTCTGTCTTTCCCAAGGAGCGC
GAGGTGCTGATTCCCCCCCATGAAGTCTTTTTGGTTACCAGATTCTCTCAGGATGGAGCC
CAGAGCTTGGTGACTCTCTGGAGCTATAATCAGACCTGTAGCCATTTTAACTGCGCCTAT
CTGGGTGGGGAGAAGAGGCGGGGCTGTGTGTCTGCGCCAGGAGCCCTGGGAACGGGTGAC
CTTCATATGACGAAGAGGCACCTCCAGCAGCCTTGA
Protein Properties
Number of Residues 291
Molecular Weight 32053.48
Theoretical pI 8.266
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Ecto-ADP-ribosyltransferase 5
MALAALMIALGSLGLHTWQAQAVPILPLGLAPDTFDDTYVGCAEEMEEKAAPLLKEEMAH
HALLRESWEAAQETWEDKRRGLTLPPGFKAQNGIAIMVYTNSSNTLYWELNQAVRTGGGS
RELYMRHFPFKALHFYLIRALQLLRGSGGCSRGPGEVVFRGVGSLRFEPKRLGDSVRLGQ
FASSSLDKAVAHRFGNATLFSLTTCFGAPIQAFSVFPKEREVLIPPHEVFLVTRFSQDGA
QSLVTLWSYNQTCSHFNCAYLGGEKRRGCVSAPGALGTGDLHMTKRHLQQP
GenBank ID Protein 118640870
UniProtKB/Swiss-Prot ID Q96L15
UniProtKB/Swiss-Prot Entry Name NAR5_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_001079536.1
GeneCard ID ART5
GenAtlas ID ART5
HGNC ID HGNC:24049
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Taylor TD, Noguchi H, Totoki Y, Toyoda A, Kuroki Y, Dewar K, Lloyd C, Itoh T, Takeda T, Kim DW, She X, Barlow KF, Bloom T, Bruford E, Chang JL, Cuomo CA, Eichler E, FitzGerald MG, Jaffe DB, LaButti K, Nicol R, Park HS, Seaman C, Sougnez C, Yang X, Zimmer AR, Zody MC, Birren BW, Nusbaum C, Fujiyama A, Hattori M, Rogers J, Lander ES, Sakaki Y: Human chromosome 11 DNA sequence and analysis including novel gene identification. Nature. 2006 Mar 23;440(7083):497-500. [PubMed:16554811 ]
  3. Clark HF, Gurney AL, Abaya E, Baker K, Baldwin D, Brush J, Chen J, Chow B, Chui C, Crowley C, Currell B, Deuel B, Dowd P, Eaton D, Foster J, Grimaldi C, Gu Q, Hass PE, Heldens S, Huang A, Kim HS, Klimowski L, Jin Y, Johnson S, Lee J, Lewis L, Liao D, Mark M, Robbie E, Sanchez C, Schoenfeld J, Seshagiri S, Simmons L, Singh J, Smith V, Stinson J, Vagts A, Vandlen R, Watanabe C, Wieand D, Woods K, Xie MH, Yansura D, Yi S, Yu G, Yuan J, Zhang M, Zhang Z, Goddard A, Wood WI, Godowski P, Gray A: The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment. Genome Res. 2003 Oct;13(10):2265-70. Epub 2003 Sep 15. [PubMed:12975309 ]
  4. Glowacki G, Braren R, Firner K, Nissen M, Kuhl M, Reche P, Bazan F, Cetkovic-Cvrlje M, Leiter E, Haag F, Koch-Nolte F: The family of toxin-related ecto-ADP-ribosyltransferases in humans and the mouse. Protein Sci. 2002 Jul;11(7):1657-70. [PubMed:12070318 ]