You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP00983
Secondary Accession Numbers
  • 6271
Name Inositol-trisphosphate 3-kinase B
Synonyms
  1. IP3 3-kinase B
  2. IP3K B
  3. Inositol 1,4,5-trisphosphate 3-kinase B
  4. InsP 3-kinase B
Gene Name ITPKB
Protein Type Unknown
Biological Properties
General Function Involved in inositol trisphosphate 3-kinase activity
Specific Function Not Available
Pathways
  • Calcium signaling pathway
  • Inositol phosphate metabolism
  • Phosphatidylinositol signaling system
Reactions
Adenosine triphosphate + Inositol 1,4,5-trisphosphate → ADP + Inositol 1,3,4,5-tetraphosphate details
GO Classification
Biological Process
signal transduction
cell surface receptor signaling pathway
MAPK cascade
positive regulation of Ras protein signal transduction
positive thymic T cell selection
positive regulation of alpha-beta T cell differentiation
Function
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
inositol or phosphatidylinositol kinase activity
inositol trisphosphate kinase activity
inositol trisphosphate 3-kinase activity
Molecular Function
ATP binding
inositol-1,4,5-trisphosphate 3-kinase activity
Cellular Location Not Available
Gene Properties
Chromosome Location 1
Locus 1q42.13
SNPs ITPKB
Gene Sequence
>2841 bp
ATGGCTGTGTACTGCTATGCGCTCAATAGCCTGGTGATCATGAATAGCGCCAACGAGATG
AAGAGCGGCGGCGGCCCGGGGCCCAGTGGCAGCGAGACGCCCCCGCCCCCGAGGAGGGCA
GTGCTGAGCCCCGGCAGCGTTTTCAGCCCCGGGAGAGGCGCCTCTTTCCTCTTCCCCCCA
GCCGAGTCGCTGTCCCCCGAGGAGCCCCGGAGCCCCGGGGGCTGGCGGAGCGGCCGGCGC
AGGCTGAATAGTAGCAGCGGCAGTGGCAGCGGCAGCAGCGGCAGTAGCGTGAGCAGCCCA
AGTTGGGCTGGTCGCCTGCGAGGGGACCGGCAGCAGGTGGTGGCAGCCGGTACCCTCTCC
CCGCCAGGGCCGGAGGAGGCCAAGAGGAAGCTGCGGATCTTGCAGCGCGAGTTGCAGAAC
GTGCAGGTGAACCAGAAAGTGGGCATGTTTGAGGCGCACATCCAGGCACAGAGCTCCGCC
ATTCAAGCGCCCCGCAGCCCGCGTTTGGGCAGGGCTCACTCGCCCTCCCCGTGCCCCTTC
CGCAGCAGCAGTCAGCCCCCTGGAAGGGTCCTGGTTCAGGGCGCCCGGAGCGAGGAACGG
AGGACAAAGTCCTGGGGGGAGCAATGTTCAGAGACTTCAGGAACCGACTCCGGGAGGAAA
GGAGGGCCCAGCCTATGCTCCTCGCAGGTGAAGAAAGGAATGCCACCTCTTCCCGGCCGG
GCTGCCCCTACAGGATCAGAGGCTCAGGGTCCATCCGCTTTTGTAAGGATGGAGAAGGGT
ATCCCTGCCAGTCCCCGCTGTGGCTCACCCACAGCTATGGAAATTGACAAAAGGGGCTCT
CCTACCCCGGGAACTCGGAGCTGCCTAGCTCCCTCATTGGGGCTGTTCGCCCCTAGCTTC
CCGATGGCCACGGAAGTGGCAGCGAGAGTTACATCCACTGGGCCACACCGTCCACAGGAT
CTTGCCCTCACTGAGCCGTCTGGGAGAGCCCGTGAGCTTGAGGACCTGCAGCCCCCAGAG
GCCCTGGTGGAGAGGCAGGGGCAGTTTCTGGGCAGTGAGACAAGCCCAGCCCCAGAAAGG
GGCGGGCCCCGCGATGGAGAACCCCCTGGGAAGATGGGGAAAGGATATCTGCCCTGTGGC
ATGCCGGGCTCTGGGGAGCCTGAAGTGGGCAAAAGGCCAGAGGAGACGACTGTGAGCGTG
CAAAGCGCAGAGTCCTCTGATTCCCTGAGCTGGTCCAGGCTGCCCAGGGCCCTGGCCTCC
GTAGGCCCTGAGGAGGCCCGAAGTGGGGCCCCCGTGGGCGGGGGGCGTTGGCAGCTCTCC
GACAGAGTGGAGGGAGGGTCCCCAACGCTGGGCTTGCTTGGGGGCAGCCCCTCAGCACAG
CCGGGGACCGGGAATGTGGAGGCGGGAATTCCTTCTGGCAGAATGCTGGAGCCTTTGCCC
TGTTGGGACGCTGCGAAAGATCTGAAAGAACCTCAGTGCCCTCCTGGGGACAGGGTGGGT
GTGCAGCCTGGGAACTCCAGGGTTTGGCAGGGCACCATGGAGAAAGCCGGTTTGGCTTGG
ACGCGTGGCACAGGGGTGCAATCAGAGGGGACTTGGGAAAGCCAGCGGCAGGACAGTGAT
GCCCTCCCAAGTCCGGAGCTGCTACCCCAAGATCAGGACAAGCCTTTCCTGAGGAAGGCC
TGCAGCCCCAGCAACATACCTGCTGTCATCATTACAGACATGGGCACCCAGGAGGATGGG
GCCTTGGAGGAGACGCAGGGAAGCCCTCGGGGCAACCTGCCCCTGAGGAAACTGTCCTCT
TCCTCGGCCTCCTCCACGGGCTTCTCCTCATCCTACGAAGACTCAGAGGAGGACATCTCC
AGTGACCCTGAGCGCACCCTGGACCCCAACTCAGCTTTCCTGCATACCCTGGACCAGCAG
AAACCTAGAGTGAGCAAATCATGGAGGAAGATAAAAAACATGGTGCACTGGTCTCCCTTC
GTCATGTCCTTCAAGAAGAAGTACCCCTGGATCCAGCTGGCAGGACACGCAGGGAGTTTC
AAGGCAGCTGCCAATGGCAGGATCCTGAAGAAGCACTGTGAGTCAGAGCAGCGCTGCCTG
GACCGGCTGATGGTGGATGTGCTGAGGCCCTTCGTACCTGCCTACCATGGGGATGTGGTG
AAGGACGGGGAGCGCTACAACCAGATGGACGACCTGCTGGCCGACTTCGACTCGCCCTGT
GTGATGGACTGCAAGATGGGAATCAGGACCTACCTGGAGGAGGAGCTCACGAAGGCCCGG
AAGAAGCCCAGCCTGCGGAAGGACATGTACCAGAAGATGATCGAGGTGGACCCCGAGGCC
CCCACCGAGGAGGAAAAAGCACAGCGGGCTGTGACCAAGCCACGGTACATGCAGTGGCGG
GAGACCATCAGCTCCACGGCCACCCTGGGGTTCAGGATCGAGGGAATCAAGAAAGAAGAC
GGCACCGTGAACCGGGACTTCAAGAAGACCAAAACGAGGGAGCAGGTCACCGAGGCCTTC
AGAGAGTTCACTAAAGGAAACCATAACATCCTGATCGCCTATCGGGACCGGCTGAAGGCC
ATTCGAACCACTCTAGAAGTTTCTCCCTTCTTCAAGTGCCACGAGGTCATTGGCAGCTCC
CTCCTCTTCATCCACGACAAGAAGGAACAGGCCAAAGTGTGGATGATCGACTTTGGGAAA
ACCACGCCCCTGCCTGAGGGCCAGACCCTGCAGCATGACGTCCCCTGGCAGGAGGGGAAC
CGGGAGGATGGCTACCTCTCGGGGCTCAATAACCTCGTCGACATCCTGACCGAGATGTCC
CAGGATGCCCCACTCGCCTGA
Protein Properties
Number of Residues 946
Molecular Weight 102375.325
Theoretical pI 8.42
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Inositol-trisphosphate 3-kinase B
MAVYCYALNSLVIMNSANEMKSGGGPGPSGSETPPPPRRAVLSPGSVFSPGRGASFLFPP
AESLSPEEPRSPGGWRSGRRRLNSSSGSGSGSSGSSVSSPSWAGRLRGDRQQVVAAGTLS
PPGPEEAKRKLRILQRELQNVQVNQKVGMFEAHIQAQSSAIQAPRSPRLGRARSPSPCPF
RSSSQPPGRVLVQGARSEERRTKSWGEQCPETSGTDSGRKGGPSLCSSQVKKGMPPLPGR
AAPTGSEAQGPSAFVRMEKGIPASPRCGSPTAMEIDKRGSPTPGTRSCLAPSLGLFGASL
TMATEVAARVTSTGPHRPQDLALTEPSGRARELEDLQPPEALVERQGQFLGSETSPAPER
GGPRDGEPPGKMGKGYLPCGMPGSGEPEVGKRPEETTVSVQSAESSDSLSWSRLPRALAS
VGPEEARSGAPVGGGRWQLSDRVEGGSPTLGLLGGSPSAQPGTGNVEAGIPSGRMLEPLP
CWDAAKDLKEPQCPPGDRVGVQPGNSRVWQGTMEKAGLAWTRGTGVQSEGTWESQRQDSD
ALPSPELLPQDPDKPFLRKACSPSNIPAVIITDMGTQEDGALEETQGSPRGNLPLRKLSS
SSASSTGFSSSYEDSEEDISSDPERTLDPNSAFLHTLDQQKPRVSKSWRKIKNMVHWSPF
VMSFKKKYPWIQLAGHAGSFKAAANGRILKKHCESEQRCLDRLMVDVLRPFVPAYHGDVV
KDGERYNQMDDLLADFDSPCVMDCKMGIRTYLEEELTKARKKPSLRKDMYQKMIEVDPEA
PTEEEKAQRAVTKPRYMQWRETISSTATLGFRIEGIKKEDGTVNRDFKKTKTREQVTEAF
REFTKGNHNILIAYRDRLKAIRTTLEVSPFFKCHEVIGSSLLFIHDKKEQAKVWMIDFGK
TTPLPEGQTLQHDVPWQEGNREDGYLSGLNNLVDILTEMSQDAPLA
GenBank ID Protein 14329672
UniProtKB/Swiss-Prot ID P27987
UniProtKB/Swiss-Prot Entry Name IP3KB_HUMAN
PDB IDs Not Available
GenBank Gene ID AJ242780
GeneCard ID ITPKB
GenAtlas ID ITPKB
HGNC ID HGNC:6179
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [PubMed:16710414 ]
  3. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  4. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  5. Zahedi RP, Lewandrowski U, Wiesner J, Wortelkamp S, Moebius J, Schutz C, Walter U, Gambaryan S, Sickmann A: Phosphoproteome of resting human platelets. J Proteome Res. 2008 Feb;7(2):526-34. Epub 2007 Dec 19. [PubMed:18088087 ]
  6. Dewaste V, Roymans D, Moreau C, Erneux C: Cloning and expression of a full-length cDNA encoding human inositol 1,4,5-trisphosphate 3-kinase B. Biochem Biophys Res Commun. 2002 Feb 22;291(2):400-5. [PubMed:11846419 ]
  7. Takazawa K, Perret J, Dumont JE, Erneux C: Molecular cloning and expression of a new putative inositol 1,4,5-trisphosphate 3-kinase isoenzyme. Biochem J. 1991 Sep 15;278 ( Pt 3):883-6. [PubMed:1654894 ]