You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01002
Secondary Accession Numbers
  • 6290
Name Putative polypeptide N-acetylgalactosaminyltransferase-like protein 4
Synonyms
  1. GalNAc-T-like protein 4
  2. Polypeptide GalNAc transferase-like protein 4
  3. Protein-UDP acetylgalactosaminyltransferase-like protein 4
  4. UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase-like protein 4
  5. pp-GaNTase-like protein 4
Gene Name GALNTL4
Protein Type Unknown
Biological Properties
General Function Involved in polypeptide N-acetylgalactosaminyltransfera
Specific Function May catalyze the initial reaction in O-linked oligosaccharide biosynthesis, the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor (By similarity).
Pathways
  • Mucin type O-Glycan biosynthesis
  • protein glycosylation
Reactions
UDP-N-acetyl-alpha-D-galactosamine + polypeptide → Uridine 5'-diphosphate + N-acetyl-alpha-D-galactosaminyl-polypeptide details
UDP-N-acetyl-D-galactosamine + Protein serine → UDP + Tn antigen details
GO Classification
Biological Process
protein glycosylation
Cellular Component
integral to membrane
Golgi membrane
Molecular Function
polypeptide N-acetylgalactosaminyltransferase activity
Cellular Location
  1. Golgi apparatus membrane
  2. Single-pass type II membrane protein
Gene Properties
Chromosome Location 11
Locus 11p15.3
SNPs GALNTL4
Gene Sequence
>1824 bp
ATGGTGTGCACCAGGAAGACCAAAACTTTGGTGTCCACTTGCGTGATCCTGAGCGGCATG
ACTAACATCATCTGCCTGCTCTACGTGGGCTGGGTCACCAACTACATCGCCAGCGTGTAT
GTGCGGGGGCAGGAGCCGGCGCCCGACAAGAAGCTGGAGGAAGACAAAGGGGACACTCTG
AAGATTATTGAGCGGCTGGACCACCTGGAGAATGTCATCAAGCAGCACATTCAAGAGGCT
CCTGCCAAGCCTGAGGAGGCAGAGGCCGAGCCCTTCACAGACTCCTCTCTGTTTGCACAC
TGGGGCCAGGAGCTCAGCCCCGAAGGCCGGCGCGTGGCCCTGAAGCAATTCCAGTACTAC
GGCTACAACGCCTACCTCAGCGACCGCCTGCCCCTGGACCGGCCCCTGCCTGACCTCAGA
CCCAGTGGGTGCCGTAACCTCTCATTTCCTGACAGCCTGCCAGAGGTGAGCATCGTGTTC
ATCTTCGTCAATGAAGCGCTTTCAGTGCTGCTGCGCTCCATCCACTCGGCCATGGAACGC
ACGCCCCCACATCTGCTCAAGGAGATCATTCTGGTGGATGACAACAGCAGTAACGAGGAA
CTGAAGGAGAAGCTGACCGAATATGTGGACAAGGTGAACAGCCAGAAGCCAGGCTTCATC
AAAGTCGTGCGTCACAGCAAGCAGGAAGGCCTCATCCGCTCCAGGGTCAGTGGCTGGAGG
GCGGCCACTGCCCCTGTGGTGGCACTCTTTGATGCCCACGTGGAGTTCAATGTGGGCTGG
GCTGAACCTGTACTCACCCGCATCAAGGAGAACCGGAAGCGGATCATCTCGCCATCCTTT
GATAACATCAAATATGACAACTTTGAGATAGAAGAGTACCCGCTGGCTGCCCAGGGCTTT
GACTGGGAGCTGTGGTGCCGCTACCTAAATCCCCCCAAGGCCTGGTGGAAGCTGGAGAAC
TCCACAGCGCCAATCAGGAGCCCTGCCCTCATTGGCTGCTTCATTGTGGACCGGCAGTAC
TTCCAGGAGATCGGCCTGCTGGACGAAGGCATGGAAGTCTACGGGGGCGAGAATGTGGAG
CTTGGGATCAGGGTGTGGCAGTGTGGCGGGAGTGTGGAGGTCCTGCCCTGCTCACGGATT
GCCCACATTGAGCGAGCCCACAAGCCCTACACAGAGGACCTCACCGCCCATGTCCGCAGG
AACGCTCTCAGGGTGGCTGAAGTCTGGATGGATGAATTTAAAAGCCACGTCTACATGGCA
TGGAACATACCGCAGGAGGACTCAGGAATTGACATTGGGGACATCACTGCAAGGAAGGCT
CTCAGGAAACAGCTGCAGTGCAAGACCTTCCGGTGGTACCTGGTCAGCGTGTACCCAGAG
ATGAGGATGTACTCCGACATCATTGCCTATGGAGTGCTGCAGAATTCTCTGAAGACTGAT
TTGTGTCTTGACCAGGGGCCAGATACAGAGAATGTCCCCATCATGTACATCTGCCATGGG
ATGACGCCTCAGAACGTGTACTACACGAGCAGTCAGCAGATCCATGTGGGCATTCTGAGC
CCCACCGTGGATGATGATGACAACCGATGCCTGGTGGACGTCAACAGCCGGCCCCGGCTC
ATCGAATGCAGCTACGCCAAAGCCAAGAGGATGAAGCTTCACTGGCAGTTCTCTCAGGGA
GGACCCATCCAGAACCGCAAGTCTAAGCGCTGTCTGGAGCTGCAGGAGAATAGCGACCTG
GAGTTCGGCTTCCAGCTGGTGTTGCAGAAGTGCTCGGGCCAGCACTGGAGCATCACCAAC
GTCCTGAGGAGCCTCGCGTCCTGA
Protein Properties
Number of Residues 607
Molecular Weight 69559.95
Theoretical pI 6.493
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Putative polypeptide N-acetylgalactosaminyltransferase-like protein 4
MVCTRKTKTLVSTCVILSGMTNIICLLYVGWVTNYIASVYVRGQEPAPDKKLEEDKGDTL
KIIERLDHLENVIKQHIQEAPAKPEEAEAEPFTDSSLFAHWGQELSPEGRRVALKQFQYY
GYNAYLSDRLPLDRPLPDLRPSGCRNLSFPDSLPEVSIVFIFVNEALSVLLRSIHSAMER
TPPHLLKEIILVDDNSSNEELKEKLTEYVDKVNSQKPGFIKVVRHSKQEGLIRSRVSGWR
AATAPVVALFDAHVEFNVGWAEPVLTRIKENRKRIISPSFDNIKYDNFEIEEYPLAAQGF
DWELWCRYLNPPKAWWKLENSTAPIRSPALIGCFIVDRQYFQEIGLLDEGMEVYGGENVE
LGIRVWQCGGSVEVLPCSRIAHIERAHKPYTEDLTAHVRRNALRVAEVWMDEFKSHVYMA
WNIPQEDSGIDIGDITARKALRKQLQCKTFRWYLVSVYPEMRMYSDIIAYGVLQNSLKTD
LCLDQGPDTENVPIMYICHGMTPQNVYYTSSQQIHVGILSPTVDDDDNRCLVDVNSRPRL
IECSYAKAKRMKLHWQFSQGGPIQNRKSKRCLELQENSDLEFGFQLVLQKCSGQHWSITN
VLRSLAS
GenBank ID Protein 222446618
UniProtKB/Swiss-Prot ID Q6P9A2
UniProtKB/Swiss-Prot Entry Name GLTL4_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_198516.2
GeneCard ID GALNTL4
GenAtlas ID GALNTL4
HGNC ID HGNC:30488
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]