You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01039
Secondary Accession Numbers
  • 6328
  • HMDBP04937
Name 6-phosphogluconate dehydrogenase, decarboxylating
Synonyms Not Available
Gene Name PGD
Protein Type Enzyme
Biological Properties
General Function Involved in oxidoreductase activity
Specific Function Catalyzes the oxidative decarboxylation of 6-phosphogluconate to ribulose 5-phosphate and CO(2), with concomitant reduction of NADP to NADPH (By similarity).
Pathways
  • Glutathione metabolism
  • Pentose phosphate pathway
  • Warburg Effect
Reactions
6-Phosphogluconic acid + NADP → D-Ribulose 5-phosphate + CO(2) + NADPH details
6-Phosphogluconic acid + NADP → D-Ribulose 5-phosphate + Carbon dioxide + NADPH + Hydrogen Ion details
GO Classification
Biological Process
pentose biosynthetic process
pentose-phosphate shunt, oxidative branch
Cellular Component
cytosol
Function
binding
nucleotide binding
catalytic activity
oxidoreductase activity, acting on the ch-oh group of donors, nad or nadp as acceptor
nadp or nadph binding
coenzyme binding
cofactor binding
phosphogluconate dehydrogenase (decarboxylating) activity
oxidoreductase activity, acting on ch-oh group of donors
oxidoreductase activity
Molecular Function
phosphogluconate dehydrogenase (decarboxylating) activity
NADP binding
Process
metabolic process
pentose-phosphate shunt
small molecule metabolic process
alcohol metabolic process
monosaccharide metabolic process
hexose metabolic process
glucose metabolic process
oxidation reduction
glucose catabolic process
Cellular Location
  1. Cytoplasm
Gene Properties
Chromosome Location 1
Locus 1p36.22
SNPs PGD
Gene Sequence
>1452 bp
ATGGCCCAAGCTGACATCGCGCTGATCGGATTGGCCGTCATGGGCCAGAACTTAATTCTG
AACATGAATGACCACGGCTTTGTGGTCTGTGCTTTTAATAGGACTGTCTCCAAAGTTGAT
GATTTCTTGGCCAATGAGGCAAAGGGAACCAAAGTGGTGGGTGCCCAGTCCCTGAAAGAG
ATGGTCTCCAAGCTGAAGAAGCCCCGGCGGATCATCCTCCTGGTGAAGGCTGGGCAAGCT
GTGGATGATTTCATCGAGAAATTGGTACCATTGTTGGATACTGGTGACATCATCATTGAC
GGAGGAAATTCTGAATATAGGGACACCACAAGACGGTGCCGAGACCTCAAGGCCAAGGGA
ATTTTATTTGTGGGGAGCGGAGTCAGTGGTGGAGAGGAAGGGGCCCGGTATGGCCCATCG
CTCATGCCAGGAGGGAACAAAGAAGCGTGGCCCCACATCAAGACCATCTTCCAAGGCATT
GCTGCAAAAGTGGGAACTGGAGAACCCTGCTGTGACTGGGTGGGAGATGAGGGAGCAGGC
CACTTCGTGAAGATGGTGCACAACGGGATAGAGTATGGGGACATGCAGCTGATCTGTGAG
GCATACCACCTGATGAAAGACGTGCTGGGCATGGCGCAGGACGAGATGGCCCAGGCCTTT
GAGGATTGGAATAAGACAGAGCTAGACTCATTCCTGATTGAAATCACAGCCAATATTCTC
AAGTTCCAAGACACCGATGGCAAACACCTGCTGCCAAAGATCAGGGACAGCGCGGGGCAG
AAGGGCACAGGGAAGTGGACCGCCATCTCCGCCCTGGAATACGGCGTACCCGTCACCCTC
ATTGGAGAAGCTGTCTTTGCTCGGTGCTTATCATCTCTGAAGGATGAGAGAATTCAAGCT
AGCAAAAAGCTGAAGGGTCCCCAGAAGTTCCAGTTTGATGGTGATAAGAAATCATTCCTG
GAGGACATTCGGAAGGCACTCTACGCTTCCAAGATCATCTCTTACGCTCAAGGCTTTATG
CTGCTAAGGCAGGCAGCCACCGAGTTTGGCTGGACTCTCAATTATGGTGGCATCGCCCTG
ATGTGGAGAGGGGGCTGCATCATTAGAAGTGTATTCCTAGGAAAGATAAAGGATGCATTT
GATCGAAACCCGGAACTTCAGAACCTCCTACTGGACGACTTCTTTAAGTCAGCTGTTGAA
AACTGCCAGGACTCCTGGCGGCGGGCAGTCAGCACTGGGGTCCAGGCTGGCATTCCCATG
CCCTGTTTTACCACTGCCCTCTCCTTCTATGACGGGTACAGACATGAGATGCTTCCAGCC
AGCCTCATCCAGGCTCAGCGGGATTACTTCGGGGCTCACACCTATGAACTCTTGGCCAAA
CCAGGGCAGTTTATCCACACCAACTGGACAGGCCATGGTGGCACCGTGTCATCCTCGTCA
TACAATGCCTGA
Protein Properties
Number of Residues 483
Molecular Weight 53139.56
Theoretical pI 7.223
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>6-phosphogluconate dehydrogenase, decarboxylating
MAQADIALIGLAVMGQNLILNMNDHGFVVCAFNRTVSKVDDFLANEAKGTKVVGAQSLKE
MVSKLKKPRRIILLVKAGQAVDDFIEKLVPLLDTGDIIIDGGNSEYRDTTRRCRDLKAKG
ILFVGSGVSGGEEGARYGPSLMPGGNKEAWPHIKTIFQGIAAKVGTGEPCCDWVGDEGAG
HFVKMVHNGIEYGDMQLICEAYHLMKDVLGMAQDEMAQAFEDWNKTELDSFLIEITANIL
KFQDTDGKHLLPKIRDSAGQKGTGKWTAISALEYGVPVTLIGEAVFARCLSSLKDERIQA
SKKLKGPQKFQFDGDKKSFLEDIRKALYASKIISYAQGFMLLRQAATEFGWTLNYGGIAL
MWRGGCIIRSVFLGKIKDAFDRNPELQNLLLDDFFKSAVENCQDSWRRAVSTGVQAGIPM
PCFTTALSFYDGYRHEMLPASLIQAQRDYFGAHTYELLAKPGQFIHTNWTGHGGTVSSSS
YNA
GenBank ID Protein 12653201
UniProtKB/Swiss-Prot ID P52209
UniProtKB/Swiss-Prot Entry Name 6PGD_HUMAN
PDB IDs
GenBank Gene ID BC000368
GeneCard ID PGD
GenAtlas ID PGD
HGNC ID HGNC:8891
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. [PubMed:19608861 ]
  3. Tsui SK, Chan JY, Waye MM, Fung KP, Lee CY: Identification of a cDNA encoding 6-phosphogluconate dehydrogenase from a human heart cDNA library. Biochem Genet. 1996 Oct;34(9-10):367-73. [PubMed:8978909 ]