You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01056
Secondary Accession Numbers
  • 6345
Name Thiosulfate sulfurtransferase
Synonyms
  1. Rhodanese
Gene Name TST
Protein Type Unknown
Biological Properties
General Function Involved in thiosulfate sulfurtransferase activity
Specific Function Formation of iron-sulfur complexes, cyanide detoxification or modification of sulfur-containing enzymes. Other thiol compounds, besides cyanide, can act as sulfur ion acceptors. Also has weak mercaptopyruvate sulfurtransferase (MST) activity (By similarity). Together with MRPL18, acts as a mitochondrial import factor for the cytosolic 5S rRNA. Only the nascent unfolded cytoplasmic form is able to bind to the 5S rRNA.
Pathways
  • Cysteine and methionine metabolism
  • Sulfur relay system
Reactions
Thiosulfate + Hydrogen cyanide → Sulfurous acid + Thiocyanate details
3-Mercaptopyruvic acid + Sulfurous acid → Thiosulfate + Pyruvic acid details
Hydrogen cyanide + 3-Mercaptopyruvic acid → Thiocyanate + Pyruvic acid details
GO Classification
Biological Process
sulfur amino acid catabolic process
sulfide oxidation, using sulfide:quinone oxidoreductase
rRNA import into mitochondrion
cyanate catabolic process
Cellular Component
mitochondrial matrix
plasma membrane
mitochondrial inner membrane
Function
catalytic activity
transferase activity
transferase activity, transferring sulfur-containing groups
sulfurtransferase activity
thiosulfate sulfurtransferase activity
Molecular Function
thiosulfate sulfurtransferase activity
5S rRNA binding
Process
establishment of localization
transport
anion transport
inorganic anion transport
sulfate transport
ion transport
Cellular Location
  1. Mitochondrion matrix
Gene Properties
Chromosome Location 22
Locus 22q13.1
SNPs TST
Gene Sequence
>894 bp
ATGGTTCATCAGGTGCTCTACCGGGCGCTGGTCTCCACCAAGTGGCTGGCGGAGTCCATC
AGGACTGGCAAGCTGGGGCCCGGCCTGCGGGTGCTGGACGCGTCCTGGTACTCACCAGGC
ACCCGAGAGGCCCGCAAGGAGTACCTCGAGCGCCACGTACCCGGCGCCTCTTTCTTTGAC
ATAGAAGAGTGCCGGGACACGGCGTCGCCCTACGAGATGATGCTGCCCAGCGAGGCTGGC
TTCGCCGAGTATGTGGGCCGCCTGGGCATCAGCAACCACACGCACGTGGTGGTGTATGAT
GGTGAACACCTGGGCAGCTTCTATGCTCCCCGGGTCTGGTGGATGTTCCGTGTGTTTGGC
CACCGCACCGTATCAGTGCTCAATGGTGGCTTCCGGAACTGGCTGAAGGAGGGCCACCCG
GTGACATCCGAGCCCTCACGCCCAGAACCGGCCGTCTTCAAAGCCACACTGGACCGCTCC
CTGCTCAAGACCTACGAGCAGGTGCTGGAGAACCTTGAATCTAAGAGGTTCCAGCTGGTG
GATTCAAGGTCTCAAGGGCGGTTCCTGGGCACCGAGCCGGAGCCGGATGCAGTAGGACTG
GACTCGGGCCATATCCGTGGTGCCGTCAACATGCCTTTCATGGACTTCCTGACTGAGGAT
GGCTTCGAGAAGGGCCCAGAAGAGCTCCGTGCTCTGTTCCAGACCAAGAAGGTGGATCTC
TCGCAGCCTCTCATTGCCACGTGCCGCAAGGGAGTCACCGCCTGCCACGTGGCCTTGGCT
GCCTACCTCTGCGGCAAGCCTGATGTGGCCGTGTACGATGGCTCCTGGTCCGAGTGGTTT
CGCCGGGCCCCCCCAGAGAGCCGTGTGTCCCAGGGAAAGTCTGAGAAGGCCTGA
Protein Properties
Number of Residues 297
Molecular Weight 33428.69
Theoretical pI 7.252
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Thiosulfate sulfurtransferase
MVHQVLYRALVSTKWLAESIRTGKLGPGLRVLDASWYSPGTREARKEYLERHVPGASFFD
IEECRDTASPYEMMLPSEAGFAEYVGRLGISNHTHVVVYDGEHLGSFYAPRVWWMFRVFG
HRTVSVLNGGFRNWLKEGHPVTSEPSRPEPAVFKATLDRSLLKTYEQVLENLESKRFQLV
DSRSQGRFLGTEPEPDAVGLDSGHIRGAVNMPFMDFLTEDGFEKGPEELRALFQTKKVDL
SQPLIATCRKGVTACHVALAAYLCGKPDVAVYDGSWSEWFRRAPPESRVSQGKSEKA
GenBank ID Protein 193787227
UniProtKB/Swiss-Prot ID Q16762
UniProtKB/Swiss-Prot Entry Name THTR_HUMAN
PDB IDs Not Available
GenBank Gene ID AK091874
GeneCard ID TST
GenAtlas ID TST
HGNC ID HGNC:12388
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. [PubMed:19608861 ]
  4. Dunham I, Shimizu N, Roe BA, Chissoe S, Hunt AR, Collins JE, Bruskiewich R, Beare DM, Clamp M, Smink LJ, Ainscough R, Almeida JP, Babbage A, Bagguley C, Bailey J, Barlow K, Bates KN, Beasley O, Bird CP, Blakey S, Bridgeman AM, Buck D, Burgess J, Burrill WD, O'Brien KP, et al.: The DNA sequence of human chromosome 22. Nature. 1999 Dec 2;402(6761):489-95. [PubMed:10591208 ]
  5. Gevaert K, Goethals M, Martens L, Van Damme J, Staes A, Thomas GR, Vandekerckhove J: Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides. Nat Biotechnol. 2003 May;21(5):566-9. Epub 2003 Mar 31. [PubMed:12665801 ]
  6. Collins JE, Wright CL, Edwards CA, Davis MP, Grinham JA, Cole CG, Goward ME, Aguado B, Mallya M, Mokrab Y, Huckle EJ, Beare DM, Dunham I: A genome annotation-driven approach to cloning the human ORFeome. Genome Biol. 2004;5(10):R84. Epub 2004 Sep 30. [PubMed:15461802 ]
  7. Aita N, Ishii K, Akamatsu Y, Ogasawara Y, Tanabe S: Cloning and expression of human liver rhodanese cDNA. Biochem Biophys Res Commun. 1997 Feb 3;231(1):56-60. [PubMed:9070219 ]