You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01093
Secondary Accession Numbers
  • 6382
  • HMDBP04423
Name Glycogenin-1
Synonyms
  1. GN-1
  2. GN1
Gene Name GYG1
Protein Type Unknown
Biological Properties
General Function Involved in transferase activity, transferring glycosyl groups
Specific Function Self-glucosylates, via an inter-subunit mechanism, to form an oligosaccharide primer that serves as substrate for glycogen synthase.
Pathways
  • glycogen biosynthesis
Reactions
Uridine diphosphate glucose + glycogenin → Uridine 5'-diphosphate + alpha-D-glucosylglycogenin details
GO Classification
Biological Process
small molecule metabolic process
glucose metabolic process
glycogen catabolic process
glycogen biosynthetic process
Cellular Component
cytosol
Function
catalytic activity
transferase activity
transferase activity, transferring glycosyl groups
Molecular Function
metal ion binding
glucose binding
glycogenin glucosyltransferase activity
Cellular Location Not Available
Gene Properties
Chromosome Location 3
Locus 3q24-q25.1
SNPs GYG1
Gene Sequence
>1053 bp
ATGACAGATCAGGCCTTTGTGACACTAACCACAAACGATGCCTACGCCAAAGGTGCCCTG
GTCCTGGGATCATCTCTGAAACAGCACAGGACCACCAGGAGGCTGGTCGTGCTCGCCACC
CCTCAGGTCTCAGACTCCATGAGAAAAGTTTTAGAGACAGTCTTTGATGAAGTCATCATG
GTAGATGTCTTGGACAGTGGCGATTCTGCTCATCTAACCTTAATGAAGAGGCCAGAGTTG
GGTGTCACGCTGACAAAGCTCCACTGCTGGTCGCTTACACAGTATTCAAAATGTGTATTC
ATGGATGCAGATACTCTGGTCCTAGCAAATATTGATGATCTTTTTGACAGAGAAGAATTG
TCAGCAGCACCAGACCCAGGGTGGCCTGACTGCTTCAATTCCGGAGTCTTCGTTTATCAG
CCTTCAGTTGAAACATACAATCAGCTGTTGCATCTTGCTTCTGAGCAAGGTAGTTTTGAT
GGTGGGGACCAAGGCATACTGAACACATTTTTTAGCAGCTGGGCAACAACAGATATCAGA
AAACACCTGCCGTTTATTTATAACCTAAGCAGCATCTCTATATACTCCTACCTCCCGGCA
TTTAAAGTGTTTGGTGCAAGTGCCAAAGTTGTGCATTTCCTGGGACGAGTCAAACCATGG
AATTATACTTATGATCCCAAAACAAAAAGTGTCAAAAGTGAGGCCCATGATCCCAACATG
ACTCATCCAGAGTTTCTCATCCTGTGGTGGAACATCTTTACCACCAACGTTTTACCTCTG
CTTCAACAATTTGGCCTTGTCAAAGACACCTGCTCATATGTAAATGTGCTTTCAGACTTG
GTCTATACACTGGCTTTCTCTTGTGGCTTCTGTAGAAAGGAAGATGTCTCAGGAGCCATA
TCACATCTGTCCCTTGGGGAGATCCCAGCTATGGCACAGCCGTTTGTATCCTCGGAAGAA
CGGAAGGAACGATGGGAACAGGGCCAGGCTGATTATATGGGAGCAGATTCCTTTGACAAC
ATCAAGAGGAAACTTGACACTTACCTCCAGTAG
Protein Properties
Number of Residues 350
Molecular Weight 37478.2
Theoretical pI 5.397
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Glycogenin-1
MTDQAFVTLTTNDAYAKGALVLGSSLKQHRTTRRLVVLATPQVSDSMRKVLETVFDEVIM
VDVLDSGDSAHLTLMKRPELGVTLTKLHCWSLTQYSKCVFMDADTLVLANIDDLFDREEL
SAAPDPGWPDCFNSGVFVYQPSVETYNQLLHLASEQGSFDGGDQGILNTFFSSWATTDIR
KHLPFIYNLSSISIYSYLPAFKVFGASAKVVHFLGRVKPWNYTYDPKTKSVKSEAHDPNM
THPEFLILWWNIFTTNVLPLLQQFGLVKDTCSYVNVLSDLVYTLAFSCGFCRKEDVSGAI
SHLSLGEIPAMAQPFVSSEERKERWEQGQADYMGADSFDNIKRKLDTYLQ
GenBank ID Protein 20127457
UniProtKB/Swiss-Prot ID P46976
UniProtKB/Swiss-Prot Entry Name GLYG_HUMAN
PDB IDs
GenBank Gene ID NM_004130.3
GeneCard ID GYG1
GenAtlas ID GYG1
HGNC ID HGNC:4699
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Barbetti F, Rocchi M, Bossolasco M, Cordera R, Sbraccia P, Finelli P, Consalez GG: The human skeletal muscle glycogenin gene: cDNA, tissue expression and chromosomal localization. Biochem Biophys Res Commun. 1996 Mar 7;220(1):72-7. [PubMed:8602861 ]
  3. Lomako J, Mazuruk K, Lomako WM, Alonso MD, Whelan WJ, Rodriguez IR: The human intron-containing gene for glycogenin maps to chromosome 3, band q24. Genomics. 1996 May 1;33(3):519-22. [PubMed:8661012 ]
  4. van Maanen MH, Fournier PA, Palmer TN, Abraham LJ: Characterization of the human glycogenin-1 gene: identification of a muscle-specific regulatory domain. Gene. 1999 Jul 8;234(2):217-26. [PubMed:10395894 ]
  5. Zhai L, Mu J, Zong H, DePaoli-Roach AA, Roach PJ: Structure and chromosomal localization of the human glycogenin-2 gene GYG2. Gene. 2000 Jan 25;242(1-2):229-35. [PubMed:10721716 ]