You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01103
Secondary Accession Numbers
  • 6392
Name Chondroitin sulfate synthase 3
Synonyms
  1. Carbohydrate synthase 2
  2. ChSy-2
  3. Chondroitin glucuronyltransferase 3
  4. Chondroitin synthase 2
  5. Glucuronosyl-N-acetylgalactosaminyl-proteoglycan 4-beta-N-acetylgalactosaminyltransferase II
  6. N-acetylgalactosaminyl-proteoglycan 3-beta-glucuronosyltransferase 3
  7. N-acetylgalactosaminyltransferase 3
Gene Name CHSY3
Protein Type Unknown
Biological Properties
General Function Involved in transferase activity, transferring hexosyl groups
Specific Function Has both beta-1,3-glucuronic acid and beta-1,4-N-acetylgalactosamine transferase activity. Transfers glucuronic acid (GlcUA) from UDP-GlcUA and N-acetylgalactosamine (GalNAc) from UDP-GalNAc to the non-reducing end of the elongating chondroitin polymer. Specific activity is much reduced compared to CHSY1.
Pathways
  • Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate
Reactions
UDP-N-acetyl-alpha-D-galactosamine + beta-D-glucuronosyl-(1->3)-N-acetyl-beta-D-galactosaminyl-proteoglycan → Uridine 5'-diphosphate + N-acetyl-beta-D-galactosaminyl-(1->4)-beta-D-glucuronosyl-(1->3)-N-acetyl-beta-D-galactosaminyl-proteoglycan details
Uridine diphosphate glucuronic acid + N-acetyl-beta-D-galactosaminyl-(1->4)-beta-D-glucuronosyl-proteoglycan → Uridine 5'-diphosphate + beta-D-glucuronosyl-(1->3)-N-acetyl-beta-D-galactosaminyl-(1->4)-beta-D-glucuronosyl-proteoglycan details
Uridine diphosphate-N-acetylgalactosamine + D-Glucuronyl-N-acetyl-1,3-beta-D-galactosaminylproteoglycan → Uridine 5'-diphosphate + N-Acetyl-beta-D-galactosaminyl-1,4-beta-D-glucuronyl-N-acetyl-1,3-beta-D-galactosaminylproteoglycan details
UDP-D-glucuronate + → UDP + details
UDP-N-acetyl-D-galactosamine + → UDP + details
UDP-D-glucuronate + → UDP + details
UDP-N-acetyl-D-galactosamine + → UDP + details
Uridine diphosphate glucuronic acid + N-Acetyl-beta-D-galactosaminyl-(1->4)-beta-D-glucuronosylproteoglycan → Uridine 5'-diphosphate + beta-D-Glucuronosyl-(1->3)-N-acetyl-beta-D-galactosaminyl-(1->4)-beta-D-glucuronosylproteoglycan details
GO Classification
Biological Process
chondroitin sulfate biosynthetic process
carbohydrate metabolic process
Cellular Component
Golgi cisterna membrane
integral to membrane
Golgi membrane
Component
golgi membrane
membrane
cell part
organelle membrane
golgi cisterna membrane
Function
catalytic activity
transferase activity
transferase activity, transferring hexosyl groups
transferase activity, transferring glycosyl groups
Molecular Function
metal ion binding
glucuronosyl-N-acetylgalactosaminyl-proteoglycan 4-beta-N-acetylgalactosaminyltransferase activity
N-acetylgalactosaminyl-proteoglycan 3-beta-glucuronosyltransferase activity
Cellular Location
  1. Golgi apparatus
  2. Golgi stack membrane
  3. Single-pass type II membrane protein (Probable)
Gene Properties
Chromosome Location 5
Locus 5q23.3
SNPs CHSY3
Gene Sequence
>2649 bp
ATGGCTGTGCGCTCTCGCCGCCCGTGGATGAGCGTGGCATTAGGGCTGGTGCTGGGCTTC
ACCGCCGCGTCCTGGCTCATCGCCCCCAGGGTGGCGGAGCTGAGCGAGAGGAAGAGACGT
GGCTCCAGCCTCTGCTCCTACTACGGTCGCTCTGCTGCTGGCCCCCGCGCCGGCGCTCAG
CAGCCGCTCCCCCAGCCCCAGTCCCGACCACGGCAGGAGCAGTCGCCGCCCCCCGCGCGC
CAGGATCTCCAGGGGCCACCGCTGCCCGAGGCAGCACCCGGGATCACCAGTTTTCGAAGC
AGCCCCTGGCAGCAGCCACCTCCGCTGCAGCAGCGGCGGCGAGGACGCGAGCCTGAGGGC
GCGACGGGGCTTCCCGGTGCTCCAGCGGCCGAGGGGGAGCCCGAGGAGGAGGACGGGGGC
GCGGCTGGGCAGCGGAGAGACGGCCGGCCGGGGAGTAGCCACAACGGCAGCGGGGACGGG
GGCGCTGCCGCCCCGAGCGCCCGACCCCGGGACTTCCTGTACGTGGGGGTGATGACCGCG
CAGAAGTACCTGGGCAGCCGCGCGCTGGCCGCGCAGCGGACCTGGGCGCGTTTCATCCCG
GGCCGCGTGGAGTTCTTTTCCAGCCAGCAGCCCCCCAACGCCGGCCAGCCCCCGCCACCC
CTGCCTGTCATCGCGCTACCGGGTGTGGACGACTCCTATCCTCCCCAGAAAAAGTCCTTC
ATGATGATCAAGTACATGCACGACCACTACCTGGACAAGTATGAGTGGTTCATGCGCGCC
GACGACGATGTCTACATCAAAGGTGACAAATTAGAAGAGTTTCTTAGATCGCTAAACAGC
AGTAAGCCTCTCTACCTGGGACAGACTGGCCTGGGGAATATTGAAGAGCTTGGAAAGCTG
GGACTGGAGCCTGGGGAAAACTTCTGTATGGGAGGACCTGGCATGATCTTTAGCCGAGAA
GTTCTCAGGAGGATGGTGCCACATATTGGTGAATGCCTTAGAGAAATGCACACGACTCAT
GAGGATGTGGAAGTAGGAAGATGCGTTCGCCGCTTTGGTAGGGCTCAGTGTGTGTGGTCT
TTTCAGATGCAACAACTGTTCCATGAAAATTATGAACACAATCGGAAGGGTTACATCCAA
GACCTTCACAATAGCAAAATCCATGCAGCCATAACACTTCATCCCAACAAAAGGCCTGCA
TACCAATACAGGCTGCATAATTACATGCTCAGCCGCAAAATTTCTGAACTTCGCTACCGC
ACCATCCAGCTCCACAGGGAAAGTGCCCTGATGAGCAAGCTCAGTAACACAGAAGTGAGC
AAAGAGGACCAGCAGCTGGGAGTGATACCTTCTTTCAACCACTTCCAGCCTCGGGAGAGA
AATGAAGTGATAGAATGGGAGTTCCTGACAGGGAAGCTTCTATACTCAGCAGCTGAGAAC
CAGCCCCCTCGACAGAGCCTCAGTAGCATTTTAAGAACAGCACTGGATGATACCGTCCTA
CAGGTGATGGAGATGATCAATGAGAATGCCAAGAGCAGAGGACGGCTCATTGACTTCAAG
GAAATTCAGTATGGCTACCGCAGAGTTAACCCCATGCACGGGGTGGAGTACATTTTGGAT
TTACTCCTTTTATACAAAAGACACAAGGGAAGGAAACTGACTGTGCCAGTGAGACGTCAT
GCCTATCTTCAGCAGTTGTTCAGCAAGCCTTTCTTCAGAGAGACCGAAGAGCTAGATGTC
AACAGTCTTGTGGAGAGTATTAACAGTGAAACTCAGTCATTCTCCTTTATATCTAATTCT
TTAAAGATATTATCTTCTTTTCAAGGTGCCAAAGAAATGGGAGGGCACAATGAAAAGAAA
GTACACATTCTCGTTCCTCTCATCGGAAGGTATGACATTTTCTTGAGATTCATGGAGAAC
TTTGAAAACATGTGTCTTATCCCAAAGCAGAATGTAAAGTTGGTCATTATCCTTTTCAGT
AGGGATTCTGGCCAAGACTCCAGCAAGCATATTGAGCTGATAAAAGGGTACCAGAACAAG
TACCCCAAAGCAGAAATGACCCTGATCCCAATGAAGGGAGAGTTTTCCAGAGGTCTTGGT
CTTGAAATGGCTTCTGCCCAGTTTGACAATGACACTTTGCTGCTATTTTGTGATGTTGAC
TTGATCTTCAGAGAAGATTTTCTCCAACGATGTAGAGACAATACAATTCAGGGACAACAG
GTGTACTATCCCATCATCTTTAGCCAGTATGACCCAAAGGTAACAAACGGGGGAAATCCT
CCCACTGATGATTACTTCATATTCTCAAAAAAGACTGGATTTTGGAGAGACTATGGATAT
GGCATCACCTGTATTTACAAAAGTGATCTTCTAGGTGCAGGTGGATTTGATACCTCAATA
CAAGGCTGGGGACTAGAAGATGTAGATCTCTACAATAAAGTCATTCTATCTGGCTTAAGG
CCATTCAGAAGCCAAGAAGTAGGAGTGGTGCATATTTTCCATCCAGTTCATTGTGATCCT
AACTTGGACCCTAAGCAGTATAAGATGTGCTTAGGATCCAAGGCAAGTACTTTCGCCTCA
ACCATGCAACTGGCTGAACTCTGGCTTGAAAAACATTTAGGTGTCAGGTACAATCGAACT
CTCTCCTGA
Protein Properties
Number of Residues 882
Molecular Weight 100283.535
Theoretical pI 8.747
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Chondroitin sulfate synthase 3
MAVRSRRPWMSVALGLVLGFTAASWLIAPRVAELSERKRRGSSLCSYYGRSAAGPRAGAQ
QPLPQPQSRPRQEQSPPPARQDLQGPPLPEAAPGITSFRSSPWQQPPPLQQRRRGREPEG
ATGLPGAPAAEGEPEEEDGGAAGQRRDGRPGSSHNGSGDGGAAAPSARPRDFLYVGVMTA
QKYLGSRALAAQRTWARFIPGRVEFFSSQQPPNAGQPPPPLPVIALPGVDDSYPPQKKSF
MMIKYMHDHYLDKYEWFMRADDDVYIKGDKLEEFLRSLNSSKPLYLGQTGLGNIEELGKL
GLEPGENFCMGGPGMIFSREVLRRMVPHIGECLREMYTTHEDVEVGRCVRRFGGTQCVWS
YEMQQLFHENYEHNRKGYIQDLHNSKIHAAITLHPNKRPAYQYRLHNYMLSRKISELRYR
TIQLHRESALMSKLSNTEVSKEDQQLGVIPSFNHFQPRERNEVIEWEFLTGKLLYSAAEN
QPPRQSLSSILRTALDDTVLQVMEMINENAKSRGRLIDFKEIQYGYRRVNPMHGVEYILD
LLLLYKRHKGRKLTVPVRRHAYLQQLFSKPFFRETEELDVNSLVESINSETQSFSFISNS
LKILSSFQGAKEMGGHNEKKVHILVPLIGRYDIFLRFMENFENMCLIPKQNVKLVIILFS
RDSGQDSSKHIELIKGYQNKYPKAEMTLIPMKGEFSRGLGLEMASAQFDNDTLLLFCDVD
LIFREDFLQRCRDNTIQGQQVYYPIIFSQYDPKVTNGGNPPTDDYFIFSKKTGFWRDYGY
GITCIYKSDLLGAGGFDTSIQGWGLEDVDLYNKVILSGLRPFRSQEVGVVHIFHPVHCDP
NLDPKQYKMCLGSKASTFASTMQLAELWLEKHLGVRYNRTLS
GenBank ID Protein 37573674
UniProtKB/Swiss-Prot ID Q70JA7
UniProtKB/Swiss-Prot Entry Name CHSS3_HUMAN
PDB IDs Not Available
GenBank Gene ID AB086062
GeneCard ID CHSY3
GenAtlas ID CHSY3
HGNC ID HGNC:24293
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  3. Yada T, Sato T, Kaseyama H, Gotoh M, Iwasaki H, Kikuchi N, Kwon YD, Togayachi A, Kudo T, Watanabe H, Narimatsu H, Kimata K: Chondroitin sulfate synthase-3. Molecular cloning and characterization. J Biol Chem. 2003 Oct 10;278(41):39711-25. Epub 2003 Aug 7. [PubMed:12907687 ]