Canmetcon
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01115
Secondary Accession Numbers
  • 6408
  • HMDBP04987
Name Monocarboxylate transporter 2
Synonyms
  1. MCT 2
  2. Solute carrier family 16 member 7
Gene Name SLC16A7
Protein Type Transporter
Biological Properties
General Function Involved in transmembrane transport
Specific Function Proton-linked monocarboxylate transporter. Catalyzes the rapid transport across the plasma membrane of many monocarboxylates such as lactate, pyruvate, branched-chain oxo acids derived from leucine, valine and isoleucine, and the ketone bodies acetoacetate, beta-hydroxybutyrate and acetate. MCT2 is a high affinity pyruvate transporter
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
transmembrane transporter activity
substrate-specific transmembrane transporter activity
transporter activity
organic acid transmembrane transporter activity
carboxylic acid transmembrane transporter activity
monocarboxylic acid transmembrane transporter activity
secondary active monocarboxylate transmembrane transporter activity
Process
establishment of localization
transport
organic anion transport
transmembrane transport
anion transport
ion transport
Cellular Location
  1. Cell membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:1
Locus 12q13
SNPs SLC16A7
Gene Sequence
>1437 bp
ATGCCACCAATGCCAAGTGCCCCACCTGTGCATCCACCTCCAGATGGAGGATGGGGTTGG
ATTGTGGTTGGAGCAGCTTTTATCTCCATTGGATTTTCCTATGCATTCCCCAAAGCTGTC
ACCGTATTCTTCAAAGAAATTCAGCAAATATTCCACACTACCTACAGTGAAATAGCATGG
ATTTCATCCATTATGCTGGCTGTTATGTACGCAGGAGGTCCTGTAAGTAGTGTTTTGGTG
AATAAATACGGCAGCCGGCCGGTGGTGATAGCAGGAGGCTTATTATGCTGTCTTGGAATG
GTGTTGGCCTCCTTTAGTAGCAGCGTGGTACAGCTGTACCTCACTATGGGATTCATTACA
GGTTTAGGTTTAGCCTTCAACCTGCAACCCGCCTTAACCATAATTGGCAAATACTTCTAT
AGGAAGCGACCCATGGCAAATGGATTGGCCATGGCAGGAAGTCCTGTTTTCTTAAGTTCA
TTGGCTCCTTTCAATCAGTACCTTTTTAATACTTTTGGCTGGAAAGGAAGCTTCCTGATT
TTGGGAAGTCTACTTTTGAATGCCTGTGTGGCTGGTTCCCTCATGAGACCCCTTGGACCC
AATCAAACCACTTCTAAGTCTAAAAATAAGACTGGCAAAACAGAAGATGATTCAAGCCCA
AAGAAAATCAAAACGAAGAAATCAACTTGGGAAAAAGTTAATAAGTATTTAGATTTCTCC
CTTTTTAAGCATAGAGGATTTCTGATATATCTGTCTGGAAATGTCATTATGTTCCTAGGT
TTTTTTGCCCCCATTATATTCTTGGCTCCATATGCTAAAGACCAAGGAATTGATGAGTAC
TCGGCAGCTTTTCTGCTATCTGTTATGGCTTTCGTTGATATGTTTGCTAGGCCTTCTGTA
GGATTAATTGCAAACTCCAAATATATTCGACCTCGAATTCAGTACTTCTTCAGTTTTGCA
ATCATGTTCAATGGAGTGTGTCACCTCTTGTGCCCACTGGCACAGGACTACACAAGCCTG
GTATTATATGCTGTATTTTTTGGCCTTGGATTTGGGAGTGTTAGCAGTGTTCTCTTTGAA
ACTCTCATGGACCTCGTGGGTGCACCAAGATTTTCCAGTGCCGTCGGACTTGTCACAATT
GTGGAGTGTGGCCCAGTTCTTCTTGGCCCTCCTCTTGCAGGTAAATTGGTGGATTTAACT
GGAGAATATAAATACATGTACATGTCCTGTGGGGCTATTGTGGTAGCAGCAAGCGTGTGG
CTGCTCATTGGCAATGCTATCAACTATAGATTGCTTGCAAAGGAAAGGAAGGAGGAAAAT
GCAAGGCAGAAGTCCAGAGAATCTGAACCCTTGAGCAAATCTAAACATTCGGAAGATGTT
AACGTCAAAGTTTCAAATGCACAGAGTGTAACCTCAGAAAGAGAAACTAACATTTAA
Protein Properties
Number of Residues 478
Molecular Weight 52185.7
Theoretical pI 9.68
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 16-36
  • 60-80
  • 90-110
  • 116-136
  • 149-169
  • 174-194
  • 247-267
  • 283-303
  • 313-333
  • 339-359
  • 374-394
  • 407-427
Protein Sequence
>Monocarboxylate transporter 2
MPPMPSAPPVHPPPDGGWGWIVVGAAFISIGFSYAFPKAVTVFFKEIQQIFHTTYSEIAW
ISSIMLAVMYAGGPVSSVLVNKYGSRPVVIAGGLLCCLGMVLASFSSSVVQLYLTMGFIT
GLGLAFNLQPALTIIGKYFYRKRPMANGLAMAGSPVFLSSLAPFNQYLFNTFGWKGSFLI
LGSLLLNACVAGSLMRPLGPNQTTSKSKNKTGKTEDDSSPKKIKTKKSTWEKVNKYLDFS
LFKHRGFLIYLSGNVIMFLGFFAPIIFLAPYAKDQGIDEYSAAFLLSVMAFVDMFARPSV
GLIANSKYIRPRIQYFFSFAIMFNGVCHLLCPLAQDYTSLVLYAVFFGLGFGSVSSVLFE
TLMDLVGAPRFSSAVGLVTIVECGPVLLGPPLAGKLVDLTGEYKYMYMSCGAIVVAASVW
LLIGNAINYRLLAKERKEENARQKSRESEPLSKSKHSEDVNVKVSNAQSVTSERETNI
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID O60669
UniProtKB/Swiss-Prot Entry Name MOT2_HUMAN
PDB IDs Not Available
GenBank Gene ID AF058056
GeneCard ID SLC16A7
GenAtlas ID SLC16A7
HGNC ID HGNC:10928
References
General References
  1. Lin RY, Vera JC, Chaganti RS, Golde DW: Human monocarboxylate transporter 2 (MCT2) is a high affinity pyruvate transporter. J Biol Chem. 1998 Oct 30;273(44):28959-65. [PubMed:9786900 ]