You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01159
Secondary Accession Numbers
  • 6455
Name Ribosomal protein S6 kinase alpha-2
Synonyms
  1. 90 kDa ribosomal protein S6 kinase 2
  2. MAP kinase-activated protein kinase 1c
  3. MAPK-activated protein kinase 1c
  4. MAPKAP kinase 1c
  5. MAPKAPK-1c
  6. RSK-3
  7. Ribosomal S6 kinase 3
  8. S6K-alpha-2
  9. p90-RSK 2
  10. p90RSK2
  11. pp90RSK3
Gene Name RPS6KA2
Protein Type Unknown
Biological Properties
General Function Involved in protein serine/threonine kinase activity
Specific Function Serine/threonine kinase that may play a role in mediating the growth-factor and stress induced activation of the transcription factor CREB
Pathways Not Available
Reactions Not Available
GO Classification
Function
ion binding
cation binding
metal ion binding
binding
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
magnesium ion binding
protein kinase activity
protein serine/threonine kinase activity
Process
phosphorus metabolic process
phosphate metabolic process
metabolic process
signaling process
signal transmission
cellular metabolic process
protein amino acid phosphorylation
phosphorylation
signal transmission via phosphorylation event
intracellular protein kinase cascade
Cellular Location
  1. Nucleus
Gene Properties
Chromosome Location Chromosome:6
Locus 6q27
SNPs RPS6KA2
Gene Sequence
>2202 bp
ATGGACCTGAGCATGAAGAAGTTCGCCGTGCGCAGGTTCTTCTCTGTGTACCTGCGCAGG
AAGTCGCGCTCCAAGAGCTCCAGCCTGAGCCGGCTCGAGGAAGAAGGCGTCGTGAAGGAG
ATAGACATCAGCCATCATGTGAAGGAGGGCTTTGAGAAGGCAGATCCTTCCCAGTTTGAG
CTGCTGAAGGTTTTAGGACAAGGATCCTATGGAAAGGTGTTCCTGGTGAGGAAGGTGAAG
GGGTCCGACGCTGGGCAGCTCTACGCCATGAAGGTCCTTAAGAAAGCCACCCTAAAAGTT
CGGGACCGAGTGAGATCGAAGATGGAGAGAGACATCTTGGCAGAAGTGAATCACCCCTTC
ATTGTGAAGCTTCATTATGCCTTTCAGACGGAAGGAAAGCTCTACCTGATCCTGGACTTC
CTGCGGGGAGGGGACCTCTTCACCCGGCTCTCCAAAGAGGTCATGTTCACGGAGGAGGAT
GTCAAGTTCTACCTGGCTGAGCTGGCCTTGGCTTTAGACCATCTCCACAGCCTGGGGATC
ATCTACAGAGATCTGAAGCCTGAGAACATCCTCCTGGATGAAGAGGGGCACATTAAGATC
ACAGATTTCGGCCTGAGTAAGGAGGCCATTGACCACGACAAGAGAGCGTACTCCTTCTGC
GGGACGATCGAGTACATGGCGCCCGAGGTGGTGAACCGGCGAGGACACACGCAGAGTGCC
GACTGGTGGTCCTTCGGCGTGCTCATGTTTGAGATGCTCACGGGGTCCCTGCCGTTCCAG
GGGAAGGACAGGAAGGAGACCATGGCTCTCATCCTCAAAGCCAAGCTGGGGATGCCGCAG
TTCCTCAGTGGGGAGGCACAGAGTTTGCTGCGAGCTCTCTTCAAACGGAACCCCTGCAAC
CGGCTGGGTGCTGGCATTGACGGAGTGGAGGAAATTAAGCGCCATCCCTTCTTTGTGACC
ATAGACTGGAACACGCTGTACCGGAAGGAGATCAAGCCACCGTTCAAACCAGCAGTGGGC
AGGCCTGAGGACACCTTCCACTTTGACCCCGAGTTCACAGCGCGGACGCCCACAGACTCT
CCTGGCGTCCCCCCGAGTGCAAACGCTCATCACCTGTTTAGAGGATTCAGCTTTGTGGCC
TCAAGCCTGATCCAGGAGCCCTCACAGCAAGATCTGCACAAAGTCCCAGTTCACCCAATC
GTGCAGCAGTTACACGGGAACAACATCCACTTCACCGATGGCTACGAGATCAAGGAGGAC
ATCGGGGTGGGCTCCTACTCAGTGTGCAAGCGATGTGTGCATAAAGCCACAGACACCGAG
TATGCCGTGAAGATCATTGATAAGAGCAAGAGAGACCCCTCGGAAGAGATTGAGATCCTC
CTGCGGTACGGCCAGCACCCGAACATCATCACCCTCAAGGATGTCTATGATGATGGCAAG
TTTGTGTACCTGGTAATGGAGCTGATGCGTGGTGGGGAGCTCCTGGACCGCATCCTCCGG
CAGAGATACTTCTCGGAGCGCGAAGCCAGTGACGTCCTGTGCACCATCACCAAGACCATG
GACTACCTCCATTCCCAGGGGGTTGTTCATCGAGACCTGAAGCCGAGTAACATCCTGTAC
AGGGATGAGTCGGGGAGCCCAGAATCCATCCGAGTCTGCGACTTCGGCTTTGCCAAGCAG
CTGCGCGCGGGGAACGGGCTGCTCATGACACCCTGCTACACGGCCAATTTCGTGGCCCCG
GAGGTCCTGAAGCGTCAAGGCTATGATGCGGCGTGTGACATCTGGAGTTTGGGGATCCTG
TTGTACACCATGCTGGCAGGATTTACCCCTTTTGCAAATGGGCCAGACGATACCCCTGAG
GAGATTCTGGCGCGGATCGGCAGTGGGAAGTATGCCCTTTCTGGGGGAAACTGGGACTCG
ATATCTGACGCAGCTAAAGACGTCGTGTCCAAGATGCTCCACGTGGACCCTCATCAGCGC
CTGACGGCGATGCAAGTGCTCAAACACCCGTGGGTGGTCAACAGAGAGTACCTGTCCCCA
AACCAGCTCAGCCGACAGGACGTGCACCTGGTGAAGGGCGCGATGGCCGCCACCTACTTT
GCTCTAAACAGAACACCTCAGGCCCCGCGGCTGGAGCCCGTGCTGTCATCCAACCTGGCT
CAGCGCAGAGGCATGAAGAGACTCACGTCCACGCGGCTGTAG
Protein Properties
Number of Residues 733
Molecular Weight 83238.0
Theoretical pI 8.96
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Ribosomal protein S6 kinase alpha-2
MDLSMKKFAVRRFFSVYLRRKSRSKSSSLSRLEEEGVVKEIDISHHVKEGFEKADPSQFE
LLKVLGQGSYGKVFLVRKVKGSDAGQLYAMKVLKKATLKVRDRVRSKMERDILAEVNHPF
IVKLHYAFQTEGKLYLILDFLRGGDLFTRLSKEVMFTEEDVKFYLAELALALDHLHSLGI
IYRDLKPENILLDEEGHIKITDFGLSKEAIDHDKRAYSFCGTIEYMAPEVVNRRGHTQSA
DWWSFGVLMFEMLTGSLPFQGKDRKETMALILKAKLGMPQFLSGEAQSLLRALFKRNPCN
RLGAGIDGVEEIKRHPFFVTIDWNTLYRKEIKPPFKPAVGRPEDTFHFDPEFTARTPTDS
PGVPPSANAHHLFRGFSFVASSLIQEPSQQDLHKVPVHPIVQQLHGNNIHFTDGYEIKED
IGVGSYSVCKRCVHKATDTEYAVKIIDKSKRDPSEEIEILLRYGQHPNIITLKDVYDDGK
FVYLVMELMRGGELLDRILRQRYFSEREASDVLCTITKTMDYLHSQGVVHRDLKPSNILY
RDESGSPESIRVCDFGFAKQLRAGNGLLMTPCYTANFVAPEVLKRQGYDAACDIWSLGIL
LYTMLAGFTPFANGPDDTPEEILARIGSGKYALSGGNWDSISDAAKDVVSKMLHVDPHQR
LTAMQVLKHPWVVNREYLSPNQLSRQDVHLVKGAMAATYFALNRTPQAPRLEPVLSSNLA
QRRGMKRLTSTRL
GenBank ID Protein 19923570
UniProtKB/Swiss-Prot ID Q15349
UniProtKB/Swiss-Prot Entry Name KS6A2_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_021135.4
GeneCard ID RPS6KA2
GenAtlas ID RPS6KA2
HGNC ID HGNC:10431
References
General References
  1. Mungall AJ, Palmer SA, Sims SK, Edwards CA, Ashurst JL, Wilming L, Jones MC, Horton R, Hunt SE, Scott CE, Gilbert JG, Clamp ME, Bethel G, Milne S, Ainscough R, Almeida JP, Ambrose KD, Andrews TD, Ashwell RI, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beare DM, Beasley H, Beasley O, Bird CP, Blakey S, Bray-Allen S, Brook J, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Clark SY, Clark G, Clee CM, Clegg S, Cobley V, Collier RE, Collins JE, Colman LK, Corby NR, Coville GJ, Culley KM, Dhami P, Davies J, Dunn M, Earthrowl ME, Ellington AE, Evans KA, Faulkner L, Francis MD, Frankish A, Frankland J, French L, Garner P, Garnett J, Ghori MJ, Gilby LM, Gillson CJ, Glithero RJ, Grafham DV, Grant M, Gribble S, Griffiths C, Griffiths M, Hall R, Halls KS, Hammond S, Harley JL, Hart EA, Heath PD, Heathcott R, Holmes SJ, Howden PJ, Howe KL, Howell GR, Huckle E, Humphray SJ, Humphries MD, Hunt AR, Johnson CM, Joy AA, Kay M, Keenan SJ, Kimberley AM, King A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd CR, Lloyd DM, Loveland JE, Lovell J, Martin S, Mashreghi-Mohammadi M, Maslen GL, Matthews L, McCann OT, McLaren SJ, McLay K, McMurray A, Moore MJ, Mullikin JC, Niblett D, Nickerson T, Novik KL, Oliver K, Overton-Larty EK, Parker A, Patel R, Pearce AV, Peck AI, Phillimore B, Phillips S, Plumb RW, Porter KM, Ramsey Y, Ranby SA, Rice CM, Ross MT, Searle SM, Sehra HK, Sheridan E, Skuce CD, Smith S, Smith M, Spraggon L, Squares SL, Steward CA, Sycamore N, Tamlyn-Hall G, Tester J, Theaker AJ, Thomas DW, Thorpe A, Tracey A, Tromans A, Tubby B, Wall M, Wallis JM, West AP, White SS, Whitehead SL, Whittaker H, Wild A, Willey DJ, Wilmer TE, Wood JM, Wray PW, Wyatt JC, Young L, Younger RM, Bentley DR, Coulson A, Durbin R, Hubbard T, Sulston JE, Dunham I, Rogers J, Beck S: The DNA sequence and analysis of human chromosome 6. Nature. 2003 Oct 23;425(6960):805-11. [PubMed:14574404 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Oppermann FS, Gnad F, Olsen JV, Hornberger R, Greff Z, Keri G, Mann M, Daub H: Large-scale proteomics analysis of the human kinome. Mol Cell Proteomics. 2009 Jul;8(7):1751-64. doi: 10.1074/mcp.M800588-MCP200. Epub 2009 Apr 15. [PubMed:19369195 ]
  4. Denis NJ, Vasilescu J, Lambert JP, Smith JC, Figeys D: Tryptic digestion of ubiquitin standards reveals an improved strategy for identifying ubiquitinated proteins by mass spectrometry. Proteomics. 2007 Mar;7(6):868-74. [PubMed:17370265 ]
  5. Greenman C, Stephens P, Smith R, Dalgliesh GL, Hunter C, Bignell G, Davies H, Teague J, Butler A, Stevens C, Edkins S, O'Meara S, Vastrik I, Schmidt EE, Avis T, Barthorpe S, Bhamra G, Buck G, Choudhury B, Clements J, Cole J, Dicks E, Forbes S, Gray K, Halliday K, Harrison R, Hills K, Hinton J, Jenkinson A, Jones D, Menzies A, Mironenko T, Perry J, Raine K, Richardson D, Shepherd R, Small A, Tofts C, Varian J, Webb T, West S, Widaa S, Yates A, Cahill DP, Louis DN, Goldstraw P, Nicholson AG, Brasseur F, Looijenga L, Weber BL, Chiew YE, DeFazio A, Greaves MF, Green AR, Campbell P, Birney E, Easton DF, Chenevix-Trench G, Tan MH, Khoo SK, Teh BT, Yuen ST, Leung SY, Wooster R, Futreal PA, Stratton MR: Patterns of somatic mutation in human cancer genomes. Nature. 2007 Mar 8;446(7132):153-8. [PubMed:17344846 ]
  6. Wissing J, Jansch L, Nimtz M, Dieterich G, Hornberger R, Keri G, Wehland J, Daub H: Proteomics analysis of protein kinases by target class-selective prefractionation and tandem mass spectrometry. Mol Cell Proteomics. 2007 Mar;6(3):537-47. Epub 2006 Dec 27. [PubMed:17192257 ]
  7. Zhao Y, Bjorbaek C, Weremowicz S, Morton CC, Moller DE: RSK3 encodes a novel pp90rsk isoform with a unique N-terminal sequence: growth factor-stimulated kinase function and nuclear translocation. Mol Cell Biol. 1995 Aug;15(8):4353-63. [PubMed:7623830 ]
  8. Moller DE, Xia CH, Tang W, Zhu AX, Jakubowski M: Human rsk isoforms: cloning and characterization of tissue-specific expression. Am J Physiol. 1994 Feb;266(2 Pt 1):C351-9. [PubMed:8141249 ]