You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP01186
Secondary Accession Numbers
  • 6482
Name Ephrin type-B receptor 1
Synonyms
  1. EK6
  2. ELK
  3. EPH-like kinase 6
  4. NET
  5. Tyrosine-protein kinase receptor EPH-2
  6. hEK6
Gene Name EPHB1
Protein Type Enzyme
Biological Properties
General Function Involved in ephrin receptor activity
Specific Function Receptor for members of the ephrin-B family. Binds to ephrin-B1, -B2 and -B3. May be involved in cell-cell interactions in the nervous system
Pathways Not Available
Reactions Not Available
GO Classification
Component
integral to plasma membrane
membrane
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
protein tyrosine kinase activity
transmembrane receptor protein tyrosine kinase activity
binding
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
ephrin receptor activity
protein binding
protein kinase activity
Process
phosphorus metabolic process
phosphate metabolic process
enzyme linked receptor protein signaling pathway
transmembrane receptor protein tyrosine kinase signaling pathway
metabolic process
cellular metabolic process
protein amino acid phosphorylation
signaling
signaling pathway
cell surface receptor linked signaling pathway
phosphorylation
Cellular Location
  1. Membrane
  2. Single-pass type I membrane protein
Gene Properties
Chromosome Location Chromosome:3
Locus 3q21-q23
SNPs EPHB1
Gene Sequence
>2955 bp
ATGGCCCTGGATTATCTACTACTGCTCCTCCTGGCATCCGCAGTGGCTGCGATGGAAGAA
ACGTTAATGGACACCAGAACGGCTACTGCAGAGCTGGGCTGGACGGCCAATCCTGCGTCC
GGGTGGGAAGAAGTCAGTGGCTACGATGAAAACCTGAACACCATCCGCACCTACCAGGTG
TGCAATGTCTTCGAGCCCAACCAGAACAATTGGCTGCTCACCACCTTCATCAACCGGCGG
GGGGCCCATCGCATCTACACAGAGATGCGCTTCACTGTGAGAGACTGCAGCAGCCTCCCT
AATGTCCCAGGATCCTGCAAGGAGACCTTCAACTTGTATTACTATGAGACTGACTCTGTC
ATTGCCACCAAGAAGTCAGCCTTCTGGTCTGAGGCCCCCTACCTCAAAGTAGACACCATT
GCTGCAGATGAGAGCTTCTCCCAGGTGGACTTTGGGGGAAGGCTGATGAAGGTAAACACA
GAAGTCAGGAGCTTTGGGCCTCTTACTCGGAATGGTTTTTACCTCGCTTTTCAGGATTAT
GGAGCCTGTATGTCTCTTCTTTCTGTCCGTGTCTTCTTCAAAAAGTGTCCCAGCATTGTG
CAAAATTTTGCAGTGTTTCCAGAGACTATGACAGGGGCAGAGAGCACATCTCTGGTGATT
GCTCGGGGCACATGCATCCCCAACGCAGAGGAAGTGGACGTGCCCATCAAACTCTACTGC
AACGGGGATGGGGAATGGATGGTGCCTATTGGGCGATGCACCTGCAAGCCTGGCTATGAG
CCTGAGAACAGCGTGGCATGCAAGGCTTGCCCTGCAGGGACATTCAAGGCCAGCCAGGAA
GCTGAAGGCTGCTCCCACTGCCCCTCCAACAGCCGCTCCCCTGCAGAGGCGTCTCCCATC
TGCACCTGTCGGACCGGTTATTACCGAGCGGACTTTGACCCTCCAGAAGTGGCATGCACT
AGCGTCCCATCAGGTCCCCGCAATGTTATCTCCATCGTCAATGAGACGTCCATCATTCTG
GAGTGGCACCCTCCAAGGGAGACAGGTGGGCGGGATGATGTGACCTACAACATCATCTGC
AAAAAGTGCCGGGCAGACCGCCGGAGCTGCTCCCGCTGTGACGACAATGTGGAGTTTGTG
CCCAGGCAGCTGGGCCTGACGGAGTGCCGCGTCTCCATCAGCAGCCTGTGGGCCCACACC
CCCTACACCTTTGACATCCAGGCCATCAATGGAGTCTCCAGCAAGAGTCCCTTCCCCCCA
CAGCACGTCTCTGTCAACATCACCACAAACCAAGCCGCCCCCTCCACCGTTCCCATCATG
CACCAAGTCAGTGCCACTATGAGGAGCATCACCTTGTCATGGCCACAGCCGGAGCAGCCC
AATGGCATCATCCTGGACTATGAGATCCGGTACTATGAGAAGGAACACAATGAGTTCAAC
TCCTCCATGGCCAGGAGTCAGACCAACACAGCAAGGATTGATGGGCTGCGGCCTGGCATG
GTATATGTGGTACAGGTGCGTGCCCGCACTGTTGCTGGCTACGGCAAGTTCAGTGGCAAG
ATGTGCTTCCAGACTCTGACTGACGATGATTACAAGTCAGAGCTGAGGGAGCAGCTGCCC
CTGATTGCTGGCTCGGCAGCGGCCGGGGTCGTGTTCGTTGTGTCCTTGGTGGCCATCTCT
ATCGTCTGTAGCAGGAAACGGGCTTATAGCAAAGAGGCTGTGTACAGCGATAAGCTCCAG
CATTACAGCACAGGCCGAGGCTCCCCAGGGATGAAGATCTACATTGACCCCTTCACTTAC
GAGGATCCCAACGAAGCTGTCCGGGAGTTTGCCAAGGAGATTGATGTATCTTTTGTGAAA
ATTGAAGAGGTCATCGGAGCAGGGGAGTTTGGAGAAGTGTACAAGGGGCGTTTGAAACTG
CCAGGCAAGAGGGAAATCTACGTGGCCATCAAGACCCTGAAGGCAGGGTACTCGGAGAAG
CAGCGTCGGGACTTTCTGAGTGAGGCGAGCATCATGGGCCAGTTCGACCATCCTAACATC
ATTCGCCTGGAGGGTGTGGTCACCAAGAGTCGGCCTGTCATGATCATCACAGAGTTCATG
GAGAATGGTGCATTGGATTCTTTCCTCAGGCAAAATGACGGGCAGTTCACCGTGATCCAG
CTTGTGGGTATGCTCAGGGGCATCGCTGCTGGCATGAAGTACCTGGCTGAGATGAATTAT
GTGCATCGGGACCTGGCTGCTAGGAACATTCTGGTCAACAGTAACCTGGTGTGCAAGGTG
TCCGACTTTGGCCTCTCCCGCTACCTCCAGGATGACACCTCAGATCCCACCTACACCAGC
TCCTTGGGAGGGAAGATCCCTGTGAGATGGACAGCTCCAGAGGCCATCGCCTACCGCAAG
TTCACTTCAGCCAGCGACGTTTGGAGCTATGGGATCGTCATGTGGGAAGTCATGTCATTT
GGAGAGAGACCCTATTGGGATATGTCCAACCAAGATGTCATCAATGCCATCGAGCAGGAC
TACCGGCTGCCCCCACCCATGGACTGTCCAGCTGCTCTACACCAGCTCATGCTGGACTGT
TGGCAGAAGGACCGGAACAGCCGGCCCCGGTTTGCGGAGATTGTCAACACCCTAGATAAG
ATGATCCGGAACCCGGCAAGTCTCAAGACTGTGGCAACCATCACCGCCGTGCCTTCCCAG
CCCCTGCTCGACCGCTCCATCCCAGACTTCACGGCCTTTACCACCGTGGATGACTGGCTC
AGCGCCATCAAAATGGTCCAGTACAGGGACAGCTTCCTCACTGCTGGCTTCACCTCCCTC
CAGCTGGTCACCCAGATGACATCAGAAGACCTCCTGAGAATAGGCATCACCTTGGCAGGC
CATCAGAAGAAGATCCTGAACAGCATTCATTCTATGAGGGTCCAGATAAGTCAGTCACCA
ACGGCAATGGCATGA
Protein Properties
Number of Residues 984
Molecular Weight 109884.2
Theoretical pI 6.34
Pfam Domain Function
Signals
  • 1-17
Transmembrane Regions
  • 541-563
Protein Sequence
>Ephrin type-B receptor 1
MALDYLLLLLLASAVAAMEETLMDTRTATAELGWTANPASGWEEVSGYDENLNTIRTYQV
CNVFEPNQNNWLLTTFINRRGAHRIYTEMRFTVRDCSSLPNVPGSCKETFNLYYYETDSV
IATKKSAFWSEAPYLKVDTIAADESFSQVDFGGRLMKVNTEVRSFGPLTRNGFYLAFQDY
GACMSLLSVRVFFKKCPSIVQNFAVFPETMTGAESTSLVIARGTCIPNAEEVDVPIKLYC
NGDGEWMVPIGRCTCKPGYEPENSVACKACPAGTFKASQEAEGCSHCPSNSRSPAEASPI
CTCRTGYYRADFDPPEVACTSVPSGPRNVISIVNETSIILEWHPPRETGGRDDVTYNIIC
KKCRADRRSCSRCDDNVEFVPRQLGLTECRVSISSLWAHTPYTFDIQAINGVSSKSPFPP
QHVSVNITTNQAAPSTVPIMHQVSATMRSITLSWPQPEQPNGIILDYEIRYYEKEHNEFN
SSMARSQTNTARIDGLRPGMVYVVQVRARTVAGYGKFSGKMCFQTLTDDDYKSELREQLP
LIAGSAAAGVVFVVSLVAISIVCSRKRAYSKEAVYSDKLQHYSTGRGSPGMKIYIDPFTY
EDPNEAVREFAKEIDVSFVKIEEVIGAGEFGEVYKGRLKLPGKREIYVAIKTLKAGYSEK
QRRDFLSEASIMGQFDHPNIIRLEGVVTKSRPVMIITEFMENGALDSFLRQNDGQFTVIQ
LVGMLRGIAAGMKYLAEMNYVHRDLAARNILVNSNLVCKVSDFGLSRYLQDDTSDPTYTS
SLGGKIPVRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSFGERPYWDMSNQDVINAIEQD
YRLPPPMDCPAALHQLMLDCWQKDRNSRPRFAEIVNTLDKMIRNPASLKTVATITAVPSQ
PLLDRSIPDFTAFTTVDDWLSAIKMVQYRDSFLTAGFTSLQLVTQMTSEDLLRIGITLAG
HQKKILNSIHSMRVQISQSPTAMA
GenBank ID Protein 4758284
UniProtKB/Swiss-Prot ID P54762
UniProtKB/Swiss-Prot Entry Name EPHB1_HUMAN
PDB IDs
GenBank Gene ID NM_004441.4
GeneCard ID EPHB1
GenAtlas ID EPHB1
HGNC ID HGNC:3392
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Imami K, Sugiyama N, Kyono Y, Tomita M, Ishihama Y: Automated phosphoproteome analysis for cultured cancer cells by two-dimensional nanoLC-MS using a calcined titania/C18 biphasic column. Anal Sci. 2008 Jan;24(1):161-6. [PubMed:18187866 ]
  4. Zhang Z, Henzel WJ: Signal peptide prediction based on analysis of experimentally verified cleavage sites. Protein Sci. 2004 Oct;13(10):2819-24. Epub 2004 Aug 31. [PubMed:15340161 ]
  5. Muzny DM, Scherer SE, Kaul R, Wang J, Yu J, Sudbrak R, Buhay CJ, Chen R, Cree A, Ding Y, Dugan-Rocha S, Gill R, Gunaratne P, Harris RA, Hawes AC, Hernandez J, Hodgson AV, Hume J, Jackson A, Khan ZM, Kovar-Smith C, Lewis LR, Lozado RJ, Metzker ML, Milosavljevic A, Miner GR, Morgan MB, Nazareth LV, Scott G, Sodergren E, Song XZ, Steffen D, Wei S, Wheeler DA, Wright MW, Worley KC, Yuan Y, Zhang Z, Adams CQ, Ansari-Lari MA, Ayele M, Brown MJ, Chen G, Chen Z, Clendenning J, Clerc-Blankenburg KP, Chen R, Chen Z, Davis C, Delgado O, Dinh HH, Dong W, Draper H, Ernst S, Fu G, Gonzalez-Garay ML, Garcia DK, Gillett W, Gu J, Hao B, Haugen E, Havlak P, He X, Hennig S, Hu S, Huang W, Jackson LR, Jacob LS, Kelly SH, Kube M, Levy R, Li Z, Liu B, Liu J, Liu W, Lu J, Maheshwari M, Nguyen BV, Okwuonu GO, Palmeiri A, Pasternak S, Perez LM, Phelps KA, Plopper FJ, Qiang B, Raymond C, Rodriguez R, Saenphimmachak C, Santibanez J, Shen H, Shen Y, Subramanian S, Tabor PE, Verduzco D, Waldron L, Wang J, Wang J, Wang Q, Williams GA, Wong GK, Yao Z, Zhang J, Zhang X, Zhao G, Zhou J, Zhou Y, Nelson D, Lehrach H, Reinhardt R, Naylor SL, Yang H, Olson M, Weinstock G, Gibbs RA: The DNA sequence, annotation and analysis of human chromosome 3. Nature. 2006 Apr 27;440(7088):1194-8. [PubMed:16641997 ]
  6. Greenman C, Stephens P, Smith R, Dalgliesh GL, Hunter C, Bignell G, Davies H, Teague J, Butler A, Stevens C, Edkins S, O'Meara S, Vastrik I, Schmidt EE, Avis T, Barthorpe S, Bhamra G, Buck G, Choudhury B, Clements J, Cole J, Dicks E, Forbes S, Gray K, Halliday K, Harrison R, Hills K, Hinton J, Jenkinson A, Jones D, Menzies A, Mironenko T, Perry J, Raine K, Richardson D, Shepherd R, Small A, Tofts C, Varian J, Webb T, West S, Widaa S, Yates A, Cahill DP, Louis DN, Goldstraw P, Nicholson AG, Brasseur F, Looijenga L, Weber BL, Chiew YE, DeFazio A, Greaves MF, Green AR, Campbell P, Birney E, Easton DF, Chenevix-Trench G, Tan MH, Khoo SK, Teh BT, Yuen ST, Leung SY, Wooster R, Futreal PA, Stratton MR: Patterns of somatic mutation in human cancer genomes. Nature. 2007 Mar 8;446(7132):153-8. [PubMed:17344846 ]
  7. Tang XX, Biegel JA, Nycum LM, Yoshioka A, Brodeur GM, Pleasure DE, Ikegaki N: cDNA cloning, molecular characterization, and chromosomal localization of NET(EPHT2), a human EPH-related receptor protein-tyrosine kinase gene preferentially expressed in brain. Genomics. 1995 Sep 20;29(2):426-37. [PubMed:8666391 ]
  8. Stein E, Cerretti DP, Daniel TO: Ligand activation of ELK receptor tyrosine kinase promotes its association with Grb10 and Grb2 in vascular endothelial cells. J Biol Chem. 1996 Sep 20;271(38):23588-93. [PubMed:8798570 ]
  9. Freywald A, Sharfe N, Roifman CM: The kinase-null EphB6 receptor undergoes transphosphorylation in a complex with EphB1. J Biol Chem. 2002 Feb 8;277(6):3823-8. Epub 2001 Nov 16. [PubMed:11713248 ]